SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|301952|PASA_GEN_1500181 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|301952|PASA_GEN_1500181
Domain Number 1 Region: 877-1049
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-28
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 2 Region: 1107-1268
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.93e-22
Family Laminin G-like module 0.0061
Further Details:      
 
Domain Number 3 Region: 591-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000224
Family EGF-type module 0.003
Further Details:      
 
Domain Number 4 Region: 477-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000307
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 5 Region: 541-673
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000033
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 668-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000411
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 409-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000036
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 8 Region: 1711-1748
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000625
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 9 Region: 1836-1880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000656
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 10 Region: 337-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000965
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 11 Region: 292-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.011
Further Details:      
 
Domain Number 12 Region: 1629-1759
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000628
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 13 Region: 784-896
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000107
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 14 Region: 368-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000121
Family EGF-type module 0.009
Further Details:      
 
Domain Number 15 Region: 197-329
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000014
Family Growth factor receptor domain 0.0061
Further Details:      
 
Domain Number 16 Region: 1803-1840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000196
Family EGF-type module 0.018
Further Details:      
 
Domain Number 17 Region: 1751-1801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 18 Region: 1381-1610
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000775
Family Laminin G-like module 0.032
Further Details:      
 
Domain Number 19 Region: 1362-1413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000136
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 20 Region: 126-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000119
Family EGF-type module 0.013
Further Details:      
 
Domain Number 21 Region: 10-93
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000538
Family Laminin G-like module 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|301952|PASA_GEN_1500181
Domain Number - Region: 446-481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00013
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 748-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000135
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 1872-1903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000146
Family EGF-type module 0.005
Further Details:      
 
Domain Number - Region: 1081-1120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00434
Family EGF-type module 0.0093
Further Details:      
 
Domain Number - Region: 1915-1963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00879
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|301952|PASA_GEN_1500181
Sequence length 2035
Sequence
MTLSLLPANQGGRLSLSLSADANEFTTEAGFDLADNRWHDVDLRFHEDFLQIRLDDDWTP
VVNASFVQGSTLFRRDDAEAKAMTVGSGFTGCLLQGPSFPLTSIDQHLRVACPIPLGPEV
CSNATTDPCWTRPCRNFGKCSPSSGNDQGFECRCSLRYIGDRCQHDLGSLCQRPEFSCLN
GGSCHELVTGNGTSCICPPNFTGSLCENAMDLPRCSGETQSCLNGGTCFQPTNGEVLCLC
PAGFTGPRCSDNTDDCLHPSVCLNGGTCLDGINNFTCTCNGYRYQGERCETKINHCLLDT
CQNGGTCFDRFGSYVCQCAAGFSGNECQLEMASRDLRPCLNGATCVDGLANYTCLCPAGF
EGRDCQTDVDECQLPTTLCGIHSTTCTDLVGDYRCVCEPGWTGRHCDVDIDECADSPCLN
NGTCLNQLNAFQCQCPNGFSGERCEVNRDDCLPDLCRNNGTCCRCPVGFTGHLCTENIND
CVANPCQNGGSCVDGIGNYTCSCPPGFTGRNCSEDIDECAVLKPCVYGICQNTIGSYQCY
CRPGFSGDNCNLEFDECLSHPCQNNGTCNNLINGYECVCAPGFTGKDCDVNINECESNPC
QNNGTCIDGIAAYNCICLAGFTGPRCEVNIDECQSSPCLNDGLCLDGVNSYACDCNDTGF
HGLHCEVNVDDCLSAPCVHGSQCVDLVKDYQCQCHPGYEGKNCEQDVNECEPVSQPCRND
AECLERSNRTLYEPGQVFYSETEPFSYNISGGYLCRCLPGFEGVDCQINIDECALATAAS
PRGQSPCKFGTCLDGINNYTCQCLPGYEGDDCELEIDECGRYEPCQNGATCSDRVADYQC
LCPSNYGGKNCSVELLGCIDVSCLHGGTCAPYLEDETIHKFTCQCPFGFHGQLCQHATTM
SFNGSSFMPVQTNREEGYDLSFRFRTTLPKGLLAVGQGQTYYRLELLNGQLNLHSSLLNK
WEGVFLGSNLNDAEWQSVRVRFNFTHLHLAVNQLEALYPINPVESINSTETSFGMTVLGG
ATSFLRILAQGLPFFIGCMENVVVNGQWVIPSPSPSGIEPGSTANSQNMLHLPGMGVEMG
CPRTDHCRPNPCQNDGTCNDLWTFFNCSCQRPFLGDTCQFSYTAATFGHENATSSLVSVS
ITPQERLALSNSMDISLFVRTREPTGLIFYLGTPPADSGGPSYVAAELQGGRLLVVVDLG
DGELIFPAASSPPINDGNSHLVQVIRDRLQLRVKINGTVYLNDSLTSFRPLQAQVLFLGG
LPPSARLKRRQTTLPTSISSQLASGQQQPIGISVQLNNNNNVLEGRNFKGILQDIQIKSG
NITRIVEIFPLEVPSRNELPDSLGTVERTGQVLQGVVSDNNCRTDPCFNGGNCTITWNDF
QCICPPGFKGKTCAELEFCAIHQCPVGGQCHNLNDGYECLSSATFNGVNSTVEYTSLGID
GSSTGLHQTVEFSFRSKQGGTVLTIQNEASAHVRFMRLDIEGRGVVIRWIAKSGLVVNES
LYELPEALDGSWHSVSLNLPGNFSLAELVAPEGQIILGGSGVETVTVHSLVERQVPDETT
ILPDEQNEENAEQPTPTGPAVMLILPDSVPYRGCLNEFRVGGLLLPFFSTSDLLSDPSAR
KFRPISTSQLDNLELECRLCYDHECQNGAKCLDPLANYTCDCLAGYQGDLCQVNIDECVD
HLCVNGDCLDGVANYTCQCRAGWTGWLCDEDINECEPDPCQNNGTCDNLIGRYFCNCTED
FVGVDCEKPRVVTCANEPCLNSANCTDLFDLVTLLANNYTCHCPFGFDGINCENPINYCS
VLDPCRNGAFCTGVSFEPGYICECDEGFTGDNCEIDINECAQRPCLNGGRCIDGVNNFTC
DCTSTGYEGYLCEVDVDECRRDDPCVRGRCLNSPGSYSCLCESEDDCGRHCDRKDPCRIE
SVCYNGAKCTSYCDDLDKLTSLPIYRCSCSEGYEGSDCSMQSVSQLEPNLKLVAIIVPIV
AALLLIALVGFVVFVMMARNKRATRGTYSPSRQEMFSPRVEMGQVMKPPPEERLI
Download sequence
Identical sequences E9GB00
jgi|Dappu1|301952|PASA_GEN_1500181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]