SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|302236|PASA_GEN_16600007 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|302236|PASA_GEN_16600007
Domain Number 1 Region: 708-924
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.19e-37
Family Eukaryotic proteases 0.0004
Further Details:      
 
Domain Number 2 Region: 348-457
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.05e-18
Family Frizzled cysteine-rich domain 0.002
Further Details:      
 
Domain Number 3 Region: 529-568
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000109
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 125-246
Classification Level Classification E-value
Superfamily SEA domain 0.00000000262
Family SEA domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|302236|PASA_GEN_16600007
Sequence length 925
Sequence
MVVLGPERTFKLRNPLVLSSSSGLQQQSSGLLHGMDDGTASIRGASISPFNTTHKIRAGD
RAPSTSSYSLSSYDDIVRDASKNGRRWPSNHCFCLMGTLFLLGTGLAFGIYYGLISGKQE
KLIEFAYRGTFRIADGDWFEPNLADVKSTAFSLKARDFEAKLDEMFKNSTIKDIYHHSEI
LTFEGERLILAYIDSNEDYDLSVFFNLYCTTKKTPTDALEMESILREELAMRFPVTVHID
PSSVEVRARSVAMSANESSDLVDRRTDLDSASERTHGRSIENDLSNYLPPYPTHPSSNGI
DSAAGVKKGHQSRPLLTSSTIRPAVTSPGPLVPIDTFFRPQDYQERSGCVPISLNFCRHL
AYNFTSFPNLLGQRGAREVDRLNEAAKLLVESECSPYIVHVLCHILQPPCDPSAPTPGGF
VPPPPLSLMPRIPNHLPPCRSLCMAVMTSCKARLGLSQQISRRQDLAGNKLQSSDIATGL
RDLLRCELFPIDDGMDSCTTRPSMNYVMEADPSECVRFMTSSDEVACNYCPEGQVHCGVG
AACIDVNKRCDGFPDCPNGSDERGCLTVAPDMAAANFVHQYFHEGYIVFTEGNNTGKICV
DSLNSSSLMSTARQQSFLEIFGESACRSMSYRIMERIEIRIDNERSADYAHLTEPIRWRA
TFLRAPCRKRFIQSNRTCLSHFGIDSECGNRPVHMHPDRPGTDLTLLPSAHGDWPWFSAL
IRDGVHACDATLVADQWLLTASSCFDGQSRAHWVARFAAVRLTSDAPWEQERRIIGMVKS
PMKGNQLVLIKMESPVIYSDFVRPVCLARDHEAWISGPTSRCLYLGWGQDRDNLHEVTAK
VVQNPKCDNVTMLCADVLSNLDACRNDEFAGSPLLCQLNDGGSWSLVGVSNENRHCDRSF
DDPSQSRIYLGVSSISDWVMQTVRR
Download sequence
Identical sequences E9HML5
jgi|Dappu1|302236|PASA_GEN_16600007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]