SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|302555|PASA_GEN_1800057 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|302555|PASA_GEN_1800057
Domain Number 1 Region: 58-118
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000126
Family Tachycitin 0.011
Further Details:      
 
Domain Number 2 Region: 206-266
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000012
Family Tachycitin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|302555|PASA_GEN_1800057
Sequence length 314
Sequence
MARTSMFKLAAVSVVLFGLWAADASSEFDEEDLLSQFEDNPFEDFELRNYGNQQWGNGFC
AGKRDGNYVNPADPHSFYQCHQNGVTLLRHCDPRTVYDPPPRDRCEWPHLVQGCNGRYGN
CRNKEPIMVLPLPLPTPPILLPTPPLPPPPDYQRDGECSDSPQCQSCKPPTVPSYQPRVS
LRRSARETIQSQENLDESEFDLRYSSNSFCAGKNDGNYINPSNPFSLYQCHQNGKLYELP
CQGGTVYDPPPADRCEWPNLVKGCNGGYGRGCGYAPIRVPVTTAPSPGQCNAICTPHVTQ
SPAHYINKYQQYGR
Download sequence
Identical sequences E9GE47
jgi|Dappu1|302555|PASA_GEN_1800057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]