SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|302578|PASA_GEN_1800084 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|302578|PASA_GEN_1800084
Domain Number 1 Region: 5-279
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.48e-63
Family Eukaryotic proteases 0.00026
Further Details:      
 
Domain Number 2 Region: 300-362
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000628
Family Tachycitin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|302578|PASA_GEN_1800084
Sequence length 365
Sequence
MKLIFSLLSIFLLFVNGSGAVECGIANRPFSRIVGGMETKPNEFPWMVYLKVQFWSGDSA
QCGGTLISDRWILTAAHCLYGVVDVTAILGAHDVTNSNSLSRQEFSTKKWNIHPLWSYGQ
VENDIALVQLPVAAVMSDYARPACLPYSDDPNFVDFDVTITGWGNYSSSVDSGTSPVLRS
VRSSIIDSSGTTGICQQKASGEGPFHGDKIICSDSSYNRHFCHGDDGGPMNLYNSYWNTY
TVVGVAWIGDTSVDCSISTKPNICARVSYFIDWIHDTTGIPRIPRPTTTTTTTTPPAPTT
SYFTCEGKPSGIYPNPACDCCTTFYKCSNGYAYLYDCPDAGTVFDPQISVCVYPGNLPAC
GGSAR
Download sequence
Identical sequences E9GEG7
jgi|Dappu1|302578|PASA_GEN_1800084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]