SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|302654|PASA_GEN_1800173 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|302654|PASA_GEN_1800173
Domain Number 1 Region: 38-309
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.98e-64
Family Eukaryotic proteases 0.0005
Further Details:      
 
Domain Number 2 Region: 374-437
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000162
Family Tachycitin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|302654|PASA_GEN_1800173
Sequence length 440
Sequence
MKVIFASIVVLFFVTSMLPATVGQSGDVVPCKIDPLSARGVVWHQEPKATIQCGVANQMN
SRIVAGSVVAPNEFPWMAFLRIYFWSGDSAQCGGTVIDGRWILTAAHCTFGAVNISVSLG
AHDITSTSNDNFRQEFSTRKWITHPSWRYGDVENDIALIELPYAASLSNYVRPACLPYAD
DSNQLGNPVTLIGWGNYSSTSNTGFSAYLRKTLTTVISSDGTNGQCQQQSGVGSFTGDKI
ICGDGSQGRRFCYGDDGGPMNLYDSYWGTYSVVGVAWMGDSSDNCQNSRLPNIYTRVSYY
VDWIYNNTDIVPVPKPVTTTTTTTTTTTTTTTTTRPPTTTPTTTRSTTTTPTTTTPTTTK
ATTTVTDAPTPTSYPSQFDCKGKPNGVYPNPWNDCSRTFFYCSNGYSYEYICPDAGTVFN
EFICDCDYPSNVAGCLDEVK
Download sequence
Identical sequences E9GEG9
jgi|Dappu1|302654|PASA_GEN_1800173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]