SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|302707|PASA_GEN_18300009 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|302707|PASA_GEN_18300009
Domain Number 1 Region: 395-473
Classification Level Classification E-value
Superfamily HMG-box 0.000000157
Family HMG-box 0.0076
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|302707|PASA_GEN_18300009
Domain Number - Region: 230-304
Classification Level Classification E-value
Superfamily HMG-box 0.000367
Family HMG-box 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|302707|PASA_GEN_18300009
Sequence length 506
Sequence
MGNERKPTRFYDDVASTSSTIARMNEGSRKRKAPSSPIPDDNSHSPLVEADDEDDEGRED
EEEEKEDSDDEILDDDLEGNDVEEEDEEENGIASAWPKSDDCELFKRIRKACPKDDAMKY
ESRVNHLNWESIILQKSVKIGGYMFKYTHLRNYRILAEVLEDAESWNTQKHPDDQPKKPR
TSYMLPSMEQKDAVLEKPSGLEVKNEMAPKTLISPTLAASSQLLFKAGNMTEPLKPPTSA
AAYYDMTHPSRLGERTPGEIDVVWLRLSVEQRKKCIEEHSKKYEEYVFDMFEFAKSLNPA
ELRSFQIFMRNRARGLEDGDKNSKCTSASLKSSEGFSDSPLKKPASSADSKSAKSPSKIQ
PSVNANVKSSTEKEDSTILTSSTLVASQSLFKAEKMTEPIKPPASAAGYYVMTHHSKLSN
LTPAEIDALWGTLSEKEMKKCIEEHKKKHEDYVRDFENFIRILNPAELRSYRTILKIRAR
DQEDEVQESSDEESSDEERNDEERML
Download sequence
Identical sequences E9HP99
jgi|Dappu1|302707|PASA_GEN_18300009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]