SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|302743|PASA_GEN_18700019 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|302743|PASA_GEN_18700019
Domain Number 1 Region: 110-168
Classification Level Classification E-value
Superfamily BPTI-like 1.13e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0068
Further Details:      
 
Domain Number 2 Region: 38-97
Classification Level Classification E-value
Superfamily BPTI-like 2.86e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|302743|PASA_GEN_18700019
Sequence length 182
Sequence
MLLVQPVKFVLFFVYVTSTNAWANPEFDADPATVEDARNRPSVCFLPPIEGSIQCKGFFI
RWTYNAQTEKCEKFIYGGCFGTANLFRNQHACLAKCNRKGLNELISDGGSSICLQKKDEG
SRSCSASIPSYFFEATSGLCKPFRFSGCDGNGNRFPTEQECEQACYYGPSVAAVCDPALS
TV
Download sequence
Identical sequences E9HPM8
jgi|Dappu1|302743|PASA_GEN_18700019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]