SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|302974|PASA_GEN_0200037 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|302974|PASA_GEN_0200037
Domain Number 1 Region: 22-184
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000021
Family C-type lectin domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|302974|PASA_GEN_0200037
Sequence length 187
Sequence
MAPSMFASAIISSVVFHSLIAMTSVVASTSTQSYAVCPQYLRSAYGGPVPCWLLDNGNCY
CFSLYMECWSNANYMCTQGGMSLVAIETGEEDSVISRHLMNIPELKGYAYWTAGRYNDTE
WQWFSNKKPITFDDLKNTDKVKDKEAVSNRCILLNYVEEDYPSGGYASRICASFGYRFVC
EATAPSQ
Download sequence
Identical sequences E9FSK9
jgi|Dappu1|302974|PASA_GEN_0200037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]