SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|303124|PASA_GEN_0200216 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|303124|PASA_GEN_0200216
Domain Number 1 Region: 40-104
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000568
Family Ovomucoid domain III-like 0.0088
Further Details:      
 
Domain Number 2 Region: 161-236
Classification Level Classification E-value
Superfamily EF-hand 0.00000000377
Family Calmodulin-like 0.03
Further Details:      
 
Domain Number 3 Region: 242-283
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000659
Family VWC domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|303124|PASA_GEN_0200216
Sequence length 381
Sequence
MLRILGLVSLFCILFQAALASNSEENALDMSLVEDECSMMVCRAGRECKVGADGEAACAC
LATCPDHFVPVCGSNNQSYDNFCLMHRDACLTGVHISLKKKGYCSNKSIKKKSSKKDKLK
DENHFEPVVCFQWERDALRRQIINYFRHHTADQSWYRPDLKSYEKQFARFFMCDTTKDNF
VDANELAACVTEVPFALRTTAATNELVKVLCVDAIIDSADTNSDWRLDFEEYKTLMDSSF
QPKEKLCSLEGKKYEDGSQTKVDCNDCVCACGSWVCSSKKCDEELNEIDDLDEDEDLDDE
LDEAEDQSEDNTKDEVKILKIEEDIDLKIDDPDEDQPPKINSDDDDDMDDEEDEEDDEEE
DEEIDVEPIKKSSKNKKKKLT
Download sequence
Identical sequences E9FSS4
jgi|Dappu1|303124|PASA_GEN_0200216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]