SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|303147|PASA_GEN_0200257 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|303147|PASA_GEN_0200257
Domain Number 1 Region: 786-904
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000124
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 2 Region: 487-607
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000298
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 276-405
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000137
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 705-817
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000157
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 571-679
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000816
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 6 Region: 962-1013
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000139
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 7 Region: 208-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 8 Region: 1002-1065
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000528
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 9 Region: 403-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000294
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 451-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000021
Family EGF-type module 0.0052
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|303147|PASA_GEN_0200257
Domain Number - Region: 1-27
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0171
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|303147|PASA_GEN_0200257
Sequence length 1487
Sequence
MDECELEDVGQTCAGTCINTIGSFRCSEEDDASSQEDRQDPENEEDDGEAAEAIQEAATS
SSTQTSTTTSTTSTTPTTTTTSTTPTPTTTSTEATTTTSIPTTMEAITTTTTTTESPALI
PAEEEDEDEENGEEEEGGEEESEDGEEEEPEEPEDNKIDPITTTTTPPPAAAVVETKEEE
KIPELEETCPEGFQLADRLAEAEDGSACLDVDECATEDQFGCSHLCVNTQGSAHCDCPNG
WKMTNDGKTCRGNQFCKSSSQEFSIFKKMVGLDFPDIDECSTGNNFGCSHQCVNTDGSAH
CSCPSGYSLDASDHKTCVDVDECSDQTQPNFGCSHHCVNLPGSAECKCTAGYKLRADQKT
CKDIDECAKENGGCSHECVNLKGGMRCECPGGYRLSETDAKSCLDIDECASLDEETQHSC
RATGGSCHNTLGSYQCICPEGFRSIGTACTDIDECAELSPCSTACTNLQGSYRCDCDDGF
ENVNGTCADINECPNGVCDQLCTNIPGSYICDCHPGYQLIGDVCIDIDECAIGNPCDDIC
RNTVGAFECLCAQGFQLNNDDQCVDIDECLNDPCEGICINTQGSYSCSCELGYQLGDNGT
CSDVDECLSSPCPVECINSPGSFTCLCPFGYEFNDNVCKDIDECQKQPCGTNAKCINNEG
SFACQCEPGYALRGRDCEELVVYTEEEDRQLCEYQKGVDLKKPDVDECKENPCNGACINF
PGSYQCICDPGYELRDGRCEDIDECLNYKCGGRCTNLPGSYRCDCEKGYKLEGERCVDVD
ECVSLKPCKGSCINLPGSYRCDCNAGYQTEGNECIDIDECSHRNGGCSHICVNTVGSFRC
ACNPGFDVSHKNQSNCVDVNECRSNNGGCSQDCINTRGAYHCTCSDQYYLEADGRTCIEL
PPRCPRMKVPDHGDMECTQNLNQTQHRSREQEDEALIAENGRGDLGASGRSANRSHKSRA
LYNTGSTCVIRCNKGYKLVGDSTISCGRSGLWIGEPATCIPLSCPKLLAPDNGALTPNTC
STGKTFAGQQCQVRCRAGFRLIGGGTYHCLPSQQWRSPDEPARCERIDSPVPFIQCPGNM
AVNLPAQQNRAYVTFSQPKSNMDWFRYVDSDPLWAKQLGGELPVGLNVITFRVRSPVSDL
TAACNFTIEIFDKEIPRMTNCPSSLTVFLEPGQSSQIVTWNEPIFTDNIEIVQLNKSREP
GELFQSGYHEITYVAQDGAGNQAKCQFTIHVTSPTVHRDTSSPITKLPRGRVLVRCPGIK
PGKYVEMYTYKVPAGCIVINNPSAYTRATVTTLAPRYTVFDWDFGASGGDVDGRDSANSG
RHPTSHNKLVDGVPRLRDAGAPSAPVIVPGPALIPSMGGGQTVRLSNGRARKSRINEANL
QLLPNVPSGSNDPVDHRGNKNRNRDKKRGGVVDLLLPFTANDAELQSPTTARSGRKRQHG
PKHQPKLVPGPSFVPGNERNSKIKEKKEKNTAAGSTSNNRKNKTTAS
Download sequence
Identical sequences E9FT14
jgi|Dappu1|303147|PASA_GEN_0200257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]