SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|303454|PASA_GEN_2100071 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|303454|PASA_GEN_2100071
Domain Number - Region: 70-115
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000147
Family Anti-platelet protein 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|303454|PASA_GEN_2100071
Sequence length 142
Sequence
MLIKLPSMPSIRLHFVSLRVRTMQNIGLTCICFVFAALSMSFRAVDGVPLGNKQWAEWNT
IGGGVKWLANCDFPGFDIRFEHIPVELCAKTCIDSSGCNAFSWNDGWCYLKNIPATSLRR
VPSPRGSCGFLPWEFSTSGFIS
Download sequence
Identical sequences E9GG66
jgi|Dappu1|303454|PASA_GEN_2100071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]