SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|303505|PASA_GEN_2100134 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|303505|PASA_GEN_2100134
Domain Number 1 Region: 2-91,144-399,485-591
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.32e-23
Family Glycerol-3-phosphate transporter 0.085
Further Details:      
 
Domain Number 2 Region: 413-468
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000582
Family Ovomucoid domain III-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|303505|PASA_GEN_2100134
Sequence length 632
Sequence
MFLAVFCLACVLQGMFYTYFVSVLTTIEKLFQIQSKTTGIIMSATEMGQIGGALLLTYYG
GQGHRPKWIGWGMVLFGASAALCSLPHFLFWRTKPNTGSSSSLSSMLAPDLYGGGLGLLA
TMDPSSSSEQQAISRTTTVVLAFFFLSLLGIGMGRTAVETLGIPYMDDNVAGRESPTYFA
INIGVKILGPVFGFVLGSLCTSIYVDPLVEPDVTPKDPRWIGAWWLGMIFVASTILLASL
SMFAFPRRLPRKGRQAAHRPKQINGKMLPAQAKTEQTVASAMRNKNPSLKDFPKAIRRLL
KNDILLFRTASSVLHILPVAGLYTFLPKYLESQFRMAAHTANMISGIGGIGVMGIGIFFS
GVFIRLKKPSPKFVAAWIALTALLYAIGMALLMLLGCPMSDFSGLEQTDSGMTVKLPCNR
TCECDTSVFAPICTSTGETYFSACHAGCANLTQFGSQIGNTTYSNCECLDAGVTATSGYC
HLECNNYIWYIGIFSLFVLIHSTSEVGSMLLTLRCVHAKDKAMALGLIQFAIGLFANVPC
PIIYGAVVDSACFVWEKTCGEQGACWLYDAKTFRVSFHGTTGALMLCAFFVDLVVWYKAD
KITFPEDEAPPCVEMEQLAPTAPLAVQYESTL
Download sequence
Identical sequences E9GGR7
jgi|Dappu1|303505|PASA_GEN_2100134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]