SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|303857|PASA_GEN_2400053 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|303857|PASA_GEN_2400053
Domain Number 1 Region: 44-82
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000173
Family Tachycitin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|303857|PASA_GEN_2400053
Sequence length 112
Sequence
MTSAVEYHVCCLLVVLSLSAFLCHAKEPECPFGSPKIDLADLDGRCDRFWMCEDGLISDM
FCPSGNGFNPASQKCDTNAPCLTDSSSVTTERPAGLSRIVDILIEARTNRPK
Download sequence
Identical sequences E9GIF8
jgi|Dappu1|303857|PASA_GEN_2400053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]