SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|303924|PASA_GEN_2400145 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|303924|PASA_GEN_2400145
Domain Number 1 Region: 51-285
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-26
Family YWTD domain 0.00043
Further Details:      
 
Domain Number 2 Region: 337-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000516
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|303924|PASA_GEN_2400145
Sequence length 495
Sequence
MKFGGLFIFVALKLAAVVSVKQDDLIIAVGNKLEFLKDGSTYQTLALDSYNASKFSALAY
DATTQKLFFSDIRHRHGHIFSVSLDSESRRNVEDIVEKKSNETVESLTYDPVDNVLLWTD
GLNKSIRRIQIDHDRVHSEEKAGVEVVHFLEYDAKPRGLVSDPCTRMLYWTNIHNSRPTI
ERSFLNGSRREIVVETDLLLPNSLDLDVVEQRLYWAESLPNGYFHIERSFVNGTGRQEIY
RGTGQFVVNLAVGVDYVYWSDYDHKKLWFLRKDGSSKRPLSLGTFRDPVMSVVLFRRQSI
DCCLVSSSETCQPTKEVLVKSQPEVILESTSSKHDDVDICTGFCYHNGDCTILLNSVLRC
SCPVGFSGDRCELLDGQSDAWSYDNPEVEEMDRENETMTLDQMSSSFETIAKTCIPITCF
VLIAIFAIVKLRLFTTIFESLRRDKDDNAAVVQNLENCYKMCERPFPQLQAVNAPVPDNS
WKQSGDRATLIENEF
Download sequence
Identical sequences E9GIG2
jgi|Dappu1|303924|PASA_GEN_2400145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]