SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|303927|PASA_GEN_2400149 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|303927|PASA_GEN_2400149
Domain Number 1 Region: 53-275
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-26
Family YWTD domain 0.00028
Further Details:      
 
Domain Number 2 Region: 337-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|303927|PASA_GEN_2400149
Domain Number - Region: 419-453
Classification Level Classification E-value
Superfamily Hypothetical protein MTH1184 0.0798
Family Hypothetical protein MTH1184 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|303927|PASA_GEN_2400149
Sequence length 495
Sequence
MSLKTILMCLSFTLVAGSILKHDDLVIAVGDQLEILANGSESRTLTLDSYNASKLSALSY
DATTKKLFFSDRRHRHGHIFSVKLDNESRQNPVEDIVEKNNNETVEGLAYDPVDQMLLWT
DGFNRSIRRVQINHDGIHVEENAAVEVVHFLNSEEKPRGLVVDPCTRKMYWTNRNMSRPT
IERSHLDGSRREILIEDDLLLPNALDLDVPEQMLYWANNHRNGYFRIERSFVNGTARQEI
YRGIGQFIVSLTVGSYYVYWSDYDHKNVWSLPKDGSSKNPIILRKFTQPAMGLVVFRHEP
LNCSNKSLSAEVDQSIDQSDLSIHEQSPFQPDYDVADLCLGFCYNNGECVHVNSDLRCSC
PVGFSGERCELASEKSVAWRECDTIVDEHSRAEITSLICLTAICIILLVVVVILSVQLMK
LTNGKQLRVFKRRVFKHRPDKTENSMLVEDLENCCNSFTLCERSCPQQQDLNSAAKANSW
KDGGRDCATLLKCEY
Download sequence
Identical sequences E9GIG6
jgi|Dappu1|303927|PASA_GEN_2400149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]