SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|304122|PASA_GEN_2500163 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|304122|PASA_GEN_2500163
Domain Number 1 Region: 251-843
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2.03e-163
Family Myeloperoxidase-like 0.0000001
Further Details:      
 
Domain Number 2 Region: 860-905
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000139
Family Hairpin loop containing domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|304122|PASA_GEN_2500163
Sequence length 927
Sequence
MSLRKLIEVLLMGLLLVAGIASQNCPYQPTYFEDPAYHSERPAKFLYDADQQGGGYKYSS
GGSAHCPKVGGLESHCRPAKDCAVWYDLVRKTPGTACTLENGHGKGICCPDLPLNSLHGK
PFSKAGLCQQGYKLDAHVEGIDIVAVNEAVDAGHLLMSSVKATEKRLFDNNIRVRPGSDR
HTHSWFFFHSTNESVKISNGSMYGVYTAQQLAKRYRIKPEQVHCALNRFHLKDTVISNTC
PTFPDCDLKTFNSPFRTITGICNNIHPPGHVPWGLPRTQYQRALAPNYADGLWMPRRAKN
GGELPPPRVISLSVIRDIDAPSDTDTTWMMQFAQFVDHDVLETVEAKLADGSPVPCCTDD
GLFLSEQDYAHGKCIPVEIPKDDPFYSKFRQRCMQFARSAPACRTDRRLGYVEQMNQNTH
FLDLSAVYGSSDEVALEVRTFKNGALNVTRLRKGYHYQMDLLPPDDVGPEISTCALSKAV
SGIDPPPEVRCFKAGDNRVNVSPYMVVTQTVILREHNRIAEGLAELNPHWDDERLYQETR
RILISQWHHVIYNEFLPALIGRSKMQELGLLPLQKGFSGDYDDQVNPSILNEFAGAAFRF
GHSLVPGRQDLINQQRIKEKDILLRQHFFKTQEVYPPGNVDKFLIALATVPSRSVDNYFT
EEMTNHLFEEEGKGFGMDIVSLNIQRGRDHGFNGYNAYRALCGLPVAKEFHDLLDLLSPT
MVEKFELLYDSVDDIDLFIAAVSEKKADGALVGPTFSCIIADQFLRLKRGDRYFYDLGRQ
PGSFTEDQLNEIRKISYARLVCDNSNVLSSQPLIFKSVSEVNPIVDCESFDSIPRMNLYP
WKEVENSAWHVAEDGVKWFPDCDFPGYDIGYVQQVADGGQCAQKCKESKGCNAFWASDGW
CTLKTIPSWHHRAHLSGGICGFVPEKF
Download sequence
Identical sequences E9GJD9
jgi|Dappu1|304122|PASA_GEN_2500163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]