SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|304664|PASA_GEN_0300130 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|304664|PASA_GEN_0300130
Domain Number - Region: 88-145
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000208
Family Pan module (APPLE domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|304664|PASA_GEN_0300130
Sequence length 189
Sequence
MTAVLTVLPSTEATPMGELATPVDLFKSVPQPLLTDETIAVDPRCSTCTTGCPPTCRPPT
IHPPSLCHNCDHQCPPHMPKTNKFPNLPSVTYGTNCDFCDHELYTLTCIETVFDCSSRCA
VDRKCSHFTYIAGLKGGTCMLKEAPGSGGSWASAIPSPSPYMCGYIPRRALVDFFLNICL
GKDTTGGRR
Download sequence
Identical sequences E9FVI4
jgi|Dappu1|304664|PASA_GEN_0300130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]