SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|304684|PASA_GEN_0300154 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|304684|PASA_GEN_0300154
Domain Number 1 Region: 660-924
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-45
Family YWTD domain 0.00000825
Further Details:      
 
Domain Number 2 Region: 24-162,334-522
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.7e-36
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0095
Further Details:      
 
Domain Number 3 Region: 1412-1596
Classification Level Classification E-value
Superfamily Fibronectin type III 1.22e-26
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 4 Region: 1607-1791
Classification Level Classification E-value
Superfamily Fibronectin type III 6.41e-24
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 5 Region: 1028-1068
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 6 Region: 1157-1198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 7 Region: 1208-1246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 1072-1110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 9 Region: 1121-1158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 10 Region: 1358-1395
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 11 Region: 991-1030
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 1264-1301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 13 Region: 1314-1346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 14 Region: 1783-1900
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000016
Family Fibronectin type III 0.0047
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|304684|PASA_GEN_0300154
Domain Number - Region: 1898-1989
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00902
Family Fibronectin type III 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|304684|PASA_GEN_0300154
Sequence length 2092
Sequence
MLTVHWAGEGSDVVVCLARNPTQSADASSSVFVSYDYGRTFVRKVDHLFVLPNGKPASIG
RFFNHPKVNSHYVFTDITNRQMFTTTDSVNTIQSYPLEFAPDDITFDERKPFSIIAYDKT
DRLRRLWFSRNFGMDWSMVREFVKSWFLDTTTSPTTLYVEYETPGADNVVLSSVSMFTAV
NDAKVVVTNVEDFELRDEFMLATRRNSGGDLDLLVSYKRGPFVTASFPSKLRRRDFHIAD
ISEGQLMVCVNHDSMLTNLYISNVPDDTKGVQFSLSLERVLYFYPEGAFPNSWLKDVGAE
TFIDIHRVGKLRGIYIASQFRDPNATALTKTSVTPDDLVTVVTFDKGGEWKLIQPPRYDD
EGQSIDCQRSNGCSLHLSQRLSQLYPINKTAPILTSSSAPGIIVATGVIGASLKGHPGVF
VSADAGLTWHQVLKGSYWYTMGDHGGVIVAVKMFRADAATKELLYSTDEGETWNTHQFID
EPMRVYGLITEPGENTTIFTMFGSKSGSHQWIIVTVDLRAAFQYECKDDDYKLWSPSGSL
LGRPCLLGHQISYQRRMTHSNCYNGKTYIRPTTVANCECRREDYECDFGFKEEEVTNQCV
RDPDSTIDLFSVPTKCPVGEFYNRTKGYRLVPGDTCVEGDAGSRFAPDRVSCPVSEEADF
ILVAQRQKILRIDLRNTGRLDELPLPALQNVFALEFDTRANCVYWADSLQDKIWRLCLDG
KSVPQVLVENQLESIEGMAFDWLSNNLYFVDGARSKIEVIRTDINNTGRMRRTILNGTVL
DKPRGITVHPSRGYMFYTDWSSEKACVCRANLDGSSQEKLIGSPIVQWPNGVTIDFFADR
IYWVDAKSDYIASADLDGKNVKKILEGTDQTLHPFAVAVFKNVMYWDDWNAQGIFMADKN
RGTGLTTIASRLPGVMDLKIFSQSLRHGSNACSTNSTTSVCPFLCMGRPNNGHSCICPDG
MHVELQSNGSEKCLCPDGQVPQPNGSCSRVNQTCPEDYFECQTLEMCIPSLWRCDGDNDC
YDKSDEVNCTSPSCSTTQFQCGNGRCIPLHWKCDFDNDCDDGSDETNCDYNPCSSDQFRC
NNGRCISARWRCDFEDDCRDGSDEDNCTTTPASGGNSSTAVTCRPGEFSCSSSHYCLPAA
WKCDGENDCIDGFDEVNCSNNSCEPWQFQCANKRCIMKSWVCDRENDCHDGSDEVNCTAT
STISPPRPFGNCSATMFECGNKNCVPLWWKCDGQDDCGDGSDELACPGTNHSTSVVTTTV
APDSHTCGENHFQCNNGDCIWESWVCDKESDCSQAEDEENCHGTETGGGGTECTEFRCLR
SGGCIPFSALCNGHQDCADNTDEEGCGLIMPGTNLTVECPRGSFRCDGSMCLPLRLYCNN
ATDCYDGTDELNCASDKRVYQVSRIFVDDKYSNSSTLLIEWEIPPPPAGIQLQYLPSYSI
AGRPSVNGTNQWLNTTWTNATELRLFNLTAYTVYNITVYARTLQGAVVGPAHPPSLYVTA
QTSMGAPSAPWNVTLHQVSHSEVQVRWNAPVKPNGLITTYRIYVEPTSPLLVVAVPVSKT
DVVVSHRYTAGTNYSFQVGAENRYSAGPRSARKYLTFDGSAIVPLVENLRTSSIGNSSVL
LSWSAPSGSNSNITGYQVVVKSGNFYAQYPAINTTSTSLNVTGLSPGVRYNLEVSARRMR
FTGPPSSVLAITSGEELPGISDLRASVVKGDMTAVKLEWHPPKDKRKLKWEYGVYYGVNL
KEMYQSGVRNRTTDTTFTVRELVACESYTFDVAIIGPIGYGSGSDGMVSLTTEFDHRSPP
KNVAVRPALSGSNDMAVISWAPPCVVLGSDSAGLGYLVDIRDVTLDKMSHVTLQPSRNAT
VQLPLEVHHGALYEITVQTDATGSRPSGVVTLSGPAIPPPHQLSIGKQVGGNVTLYWRDQ
DLPHEIVAHNYSYVIWISKDSSFQDLNKTLRYESKESQFQLPEDHHGEMYYAAVSIVDSH
GYSSMRSDPLDMLFVFGEEIKPAPGTSDPDATGGSTHVYVAVSIGVIIAMALAASLVMLL
VRHRRLQRSFSSFASTHFNTRSESTIFSDQTLEDDDSPVIRGFSDDEPLVIA
Download sequence
Identical sequences E9FVQ8
jgi|Dappu1|304684|PASA_GEN_0300154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]