SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|305228|PASA_GEN_3600028 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|305228|PASA_GEN_3600028
Domain Number 1 Region: 11-158
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-18
Family C-type lectin domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|305228|PASA_GEN_3600028
Sequence length 159
Sequence
MNKASGILIALFAVLGGTFAACVPGYSQIGDKCYTVPGLPRRFDYWSSNELCSVAKGDLF
HVQNITQWEDLNTFLVGLGYYDTYWTGVAAEGHPGLWVVRSTGFELIPEAVEFKAGSPSN
SATNLCLAIEYQADLGRYQWVDYPCSDEYVIVCEYRTCN
Download sequence
Identical sequences E9GQU4
jgi|Dappu1|305228|PASA_GEN_3600028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]