SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|305446|PASA_GEN_0400038 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|305446|PASA_GEN_0400038
Domain Number 1 Region: 154-273
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-17
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 2 Region: 25-121
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000034
Family Spermadhesin, CUB domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|305446|PASA_GEN_0400038
Sequence length 276
Sequence
MKMPIFCILLLTFVGFNHGNVVAPRPCGGRVFVEDSVVIEVSTAHENCHWDIQTQEDRIL
VFTVLNGNLKEAQDFLAIHDGAKEDSPILLVEDQKIHERSRKDLPASVYTTQSTASIRFT
KAPNSNLKLKIQKAVDCPFNLGTESQCGRVVDEVSCYCATFTKRSHPSQRSYCNSHNMKL
LSLENYEKELSIHNAWGNEATFLTSLTDAPNEGTWYWESTDAMLYPGYSNWCSKQPDDTG
AFGGEDCMVINYGANGCWNDCDCDKDDSDAICQALP
Download sequence
Identical sequences E9FWJ9
jgi|Dappu1|305446|PASA_GEN_0400038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]