SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|305524|PASA_GEN_0400130 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|305524|PASA_GEN_0400130
Domain Number 1 Region: 9-91,119-364
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.47e-88
Family Protein prenyltransferases 0.0000000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|305524|PASA_GEN_0400130
Sequence length 365
Sequence
MEGTMDDCKEFTKEKHAKYFLRCLNALPSSMVSLDSIRLSMSFFAISGLDVLGRLDLLDK
HRKEYINWIYLFQILPKYGDECLERCGFRGSLAATFALESQDSSRIASIENKGSVSSHPL
DTSHITMTYAAINTLLILGDDLGRIQRKGILAGVRALQLENGSFAATLEGSESDVRFVYC
ACCICYILQDWSVINIESATNYIVNSISYDGAIGQDRNQEGHAGLTFCGIAALSLMGTLE
TALSSNQKAKLVRWLVSRQQSGFQGRPNKLPVDTCYSFWVPATLKILGAHQFIDRKSNRK
FVLDTQCNIIGGLSKWIDHSSDPLHSYLGLAGLSVCEETDLVEEIHPALNVTKRAFEHWQ
KLFDN
Download sequence
Identical sequences E9FXI7
jgi|Dappu1|305524|PASA_GEN_0400130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]