SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|305532|PASA_GEN_0400141 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|305532|PASA_GEN_0400141
Domain Number 1 Region: 157-278
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-22
Family C-type lectin domain 0.0015
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|305532|PASA_GEN_0400141
Domain Number - Region: 45-125
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0288
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|305532|PASA_GEN_0400141
Sequence length 280
Sequence
MVKILLFVFLCALIFIVVSSQEKVATHRDVCGELINVDKAVVIDGPFHENCILEFRTQED
RILAFSVVDGDVKEASELFTIHDGISRASPILLAGNQKILELSRKDLPSALYSTQSTASV
RFTKTPSSKLLLKIQKAVSCSLNVGPETQCGRVVDEISCYCANFANKNHADHSMLCIDNN
MTLVSFENRTEEEFVQRTWSTQIPFWTSLTDTRRDGTWVWEGTMTILDTGDYTHWFPGRP
SSASDNEEDCMLYGGNTFLAYWGDVNCTTTLANAICEAHP
Download sequence
Identical sequences E9FXL9
jgi|Dappu1|305532|PASA_GEN_0400141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]