SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|305821|PASA_GEN_40200007 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|305821|PASA_GEN_40200007
Domain Number 1 Region: 306-375
Classification Level Classification E-value
Superfamily E set domains 0.00000000000297
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.029
Further Details:      
 
Domain Number 2 Region: 980-1031
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000361
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|305821|PASA_GEN_40200007
Domain Number - Region: 316-340,379-467
Classification Level Classification E-value
Superfamily YWTD domain 0.022
Family YWTD domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|305821|PASA_GEN_40200007
Sequence length 1120
Sequence
MNDPAYQPRQSYDLKKEELDEIRKEKMYPFYDKDAERKNGDLVTEINDNSAQVQKQLNFL
LPFFGFGFNYTWLSIHGFLGFSDSMGSSPLPPLQFPVQTWPADNDPSFISPFYSRCRIGR
MKESDQDKRATGVYFRLERDLPARYDEAGVKMRERIKWDIREAIVGAENFFPKHAIIATW
KNVSFVGGFNALETTNTFQIVIVTDEVRTYAMFNYAHLGWTTHAEAGGDTNSGQGGVPAF
VGFNAGNGTRAYEYRPYSQDMRIRDLTYKGYANQIPGRHVFRIDERVISGNCFDDETVYT
SQPLVFAPESGNMMGGMMVNVTGPCFSPDRRIICRFDTQDVVGKYIDQNRAVCIMPRVYA
TGYVDLTISIDGGNFNWKGRFYVESPQTAPEMVWFQTENFQELSPSELRLRWDKTNLTVD
ESAKVRISVWGYREDTVTPKLEYIDMLLDGVVNNGDTKLYHSDYLNRDNGPSHRQYTFGF
IQINLTTYDPKVGMSPILWSRPIPLGWYMSPQWKRFDGDKWAHEKCNNWIDYDRQMRPFT
YELPICPCMMHQAASDKGRYVPDFECDRYGNAKCEYHHGAIMCYRSGLSSRDGAGQQCCY
DKDGLLMMTSDNKWGGNPGRSHNLGLMPWNEAGKVPSLSHWQMDVVPFYTCCLWQDESSE
DCEIYRFERRASQDCVGYQPPGAAAVFGDPHFYTFDNMTYTFNGKGEFVLVRADTVRHKL
DIQARFEAIPNNIYGTARATVLTAVAAQENTSVVVEVRIRPSYAQWRYRLDVIVDQRYVY
FDTFSRHVQNFKGVTVYTPTSILNQSHVIIMFQSGAGLEVVENNRHMSARVYLPLSYMNQ
TRGLFGNWSTDLYDDFTLPDGTPGPSLDINNLESLHNSFGMKWAVDDKSDPYKGKSLFYH
ENGRSSNFFYDATFQPIYDVKPLLPVNYTSLNSTQIEQTCGTSYQCYYDYAVSLNRQYAT
YAKYYLDEIVNIKSNNLKIVISCGALPAPKNGRKSTFAYTPGTFVKFDCDPGYVLTGEDR
RWCYASAEWNWALWGDAQCIPEAEYKALQAGIIIGSILAVAVPVAIILYYVCQCLRERRA
RRHDFGYDNKKPRSVPKATTQEARISPRSSPSNSPIETQA
Download sequence
Identical sequences E9HWB3
jgi|Dappu1|305821|PASA_GEN_40200007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]