SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|305909|PASA_GEN_4200063 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|305909|PASA_GEN_4200063
Domain Number 1 Region: 76-135
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000445
Family Tachycitin 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|305909|PASA_GEN_4200063
Sequence length 671
Sequence
MVSCQEVKLGAEEVKPNGAEEASNLVKGVEGSTRPPLTGIPQIDYIWDPNLPPALNGYNL
SSYPFFYKMPGRDEMNFECDNRLDGFYASVLHKCQVYHQCLFGTRYDFMCANFTAFDQKI
FNCQFANEVDCDNSPLFYDRNEALYKEASTTPAPTPAPQVVVVRTRFVDESGREVAPPRS
QGGRFRRPQGKRRPVYYDDYYDYDYQEYYDAPANEEEDPASAGNGTTTANKPAKPQQEEG
AAPPAKPVKVGGGRQQQQQQQQNKPGSGQGNKLNIFNNNRPPPRIRPPVPNSDGNKKQPV
KTTTPTTTTALPAEEEFEYVDYVDGEVPLGEEVFATTTTTTTTTPPPPPRRRFRRPKMST
TSTTTTSAPLVEEEFFDDAAFEEEVVEPVTTAAPRPRRPNAALRATGTRPARSSTTTSTT
STTTSTVVPVAEEEPIELPSRPSPSLFNRRTAVVNILKRRGGSTTTVPPQEIFNEYDELV
EEDLAVDQAPAVVETTTAKATTTTTTTPAPTRRTTKARPPRPAISSRTRSTTEAPAVEEE
APVTPAPSVDAVEPAAPVSEDAPTTRPAVRSRLRSRPQTTPAAEEESVSTAAPVVRRGSQ
RRGPQPVSEVELDAQTDAIVPEENSRQGRELAQVPETSRIMLEESTNFDEDHGESQWSLI
HLFSRVFPQRA
Download sequence
Identical sequences E9GTM1
jgi|Dappu1|305909|PASA_GEN_4200063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]