SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|306157|PASA_GEN_4600047 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|306157|PASA_GEN_4600047
Domain Number - Region: 75-105
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00157
Family Pan module (APPLE domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|306157|PASA_GEN_4600047
Sequence length 160
Sequence
MNQSSLRWIESMIVFYLSMTLISAINWEDGEFNGQVKWSSNCDFYDEDGGGGGGGGYGDN
EIIDDDRDLIRLIGEQQSNRQDCGWLCWADTQCHYYSHSQNVCRTMSLKKKILTPGGVSQ
HPRERSAAFIHHVTMPYLADSETICGYIPSRIIAFNISVL
Download sequence
Identical sequences E9GVE7
jgi|Dappu1|306157|PASA_GEN_4600047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]