SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|306236|PASA_GEN_4700043 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|306236|PASA_GEN_4700043
Domain Number 1 Region: 556-622
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000942
Family Tachycitin 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|306236|PASA_GEN_4700043
Sequence length 702
Sequence
MVWWSTLEFVMTVLGLLASSAAQEFGARIGKRVGRIGQTNGYFYPVPQPPFNLPGAEVIT
TSRPAPTTARPAPTTVRPASTTARPTTARPAPTTARPVTFPTFPTFPTVSQCQVDPNCVG
ANCRPVGPGCGPAPTVPIRTTPRPAATTAYTTARPAPTTTRPAPTTTRQATTTRPATTRP
ATTVAYTTARPAAGCQVDPFCVGPNCAPVGPNCPRPTTAAPVRTTTRPAPTTARPAPTTA
RPTTTARPATTTLSLDYLPPVDVATTRRPATLGPCQVDPNCVGANCRPVGPGCGPAPTVP
IRTTPRPAATTAYTTARPAPTTTRPAPTTTRPAPTTTRPAITTRPATTRPATTVAYTTAR
PAAGCQVDPFCVGPNCAPVGPNCPKPTTAAPIRTTTRPAPTTARPAPTTARPAPTTARPA
TVPVRTTTVKATTPALDYLPPAVTTRAPGRPTTTEGYDYPAPENPLDFGPSSNQGTGLKF
PTTAKPTVVTTPRPAQPTTKPVARPTTARPTAAATTRRPGVQPVLSASEEEILFWDFRES
IAGEPELDYPIFDKIPTTAFTCQGKINGYYADEEARCQVFHVCSVGADDSVLQNSFLCPN
GTIFSQESFACLWWHDVECASSGQFTGLNANIGVVPPSAGGQQASSGAASSGSGIQISAS
AGASSSSSGGRGVSASASASSSTFAAGNKQAHAQAGHSNNAY
Download sequence
Identical sequences E9GW01
jgi|Dappu1|306236|PASA_GEN_4700043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]