SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|306243|PASA_GEN_4700050 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|306243|PASA_GEN_4700050
Domain Number 1 Region: 445-709
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-54
Family YWTD domain 0.00000107
Further Details:      
 
Domain Number 2 Region: 236-334,382-437
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.22e-21
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 3 Region: 150-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 4 Region: 27-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 5 Region: 67-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 6 Region: 104-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 191-227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 8 Region: 319-354
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 9 Region: 711-756
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000726
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 10 Region: 355-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000437
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|306243|PASA_GEN_4700050
Sequence length 883
Sequence
MLYHRGHTTLLITFLFLCLKSGLAGEVCASHQFECASGRCIPFSWSCDGENDCDDSSDEN
EHCRGSVHCADTEFQCSSGPRCIPLRWQCDGENDCEDRSDEDPTKCEIKKCTEEQFACKN
RAGECIPLSWICDKNADCSDGTDEEGCNVNCTADEFTCANGRCIQKRWFCDGQDDCGDNS
DEGDHCPEDSCPPDNNFNCGDNVCIPNKRKCDGFVDCSNGSDEADCPSSALNGTNQCNAQ
EFQCLNGIDCIHSSWQCDGDSDCPDGSDERNCSPSTCRPDQFRCDDGECIPGHLQCSGAA
ECNDTSDETSCNGTISTGCNPESEFDCGGGMCIGLDKVCDGVDDCGQWQDEPKGKCSVNE
CSVNNGGCMHTCTDTTWGFRCGCHPGYTLSDNSTCVDVDECLEPGTCSQTCINEKGSFKC
ECLTGYTRDPHDRTHCKANEGHSALLFTHGTDIRRFSLDRRDLTSIVNETRSSTALDFHF
ESGMLYWSDINDRRIYKAPIDEGETKAVVASGHVVKADGLAVDWIYRHLYWTDSSKESLV
SSIQVSDLEGGFRKTLLTEGLQQPRSIAVDPLEGWLYWSDWGGASRIERSGLDGSHRQVL
IDSHIKWPNGITLDRVDRRLFWVDAKMDMIGSCNYDGSNRRVVLAAGPAIGHPFAVSVFE
DWIYWSDWDHRTIMRANKFNGKNATSVTQTHSSQLPMVVHVYHSYRQPSGPNHCMPFNGR
CSHLCLPAPQINDRSAKISCACPDNFQMLDDGLNCVETHLLARNASTTTSTTSTESKTMN
DTLLTSISGREEATHSLTNDSGTITGLVIGSVVALLLVVALVGFFVYRHVVLRNATSMNF
DNPVYRKTTEDKFALSKNPPSGRSKPSAPEVEPLNHPGTNEYV
Download sequence
Identical sequences E9GW26
jgi|Dappu1|306243|PASA_GEN_4700050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]