SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|306448|PASA_GEN_0500114 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|306448|PASA_GEN_0500114
Domain Number - Region: 37-107
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00689
Family Divergent polysaccharide deacetylase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|306448|PASA_GEN_0500114
Sequence length 183
Sequence
MESALLVWSILVILLATPRLGYAVQVDEFTNDEVETVAITYGIIPGLNEVKKLFNEARRE
KREVAPEQDLSRFQTTNLNCKNSVEQLTTKFRQKIANVPKPVGSNDQATLATLANIERAI
RNASQELEEECAWKDSINKPVEATRTQFLTTEVNDMGSEGIVIYQIGIQKLEFEDPYNRP
NRP
Download sequence
Identical sequences E9FZ11
jgi|Dappu1|306448|PASA_GEN_0500114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]