SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|306454|PASA_GEN_0500120 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|306454|PASA_GEN_0500120
Domain Number 1 Region: 136-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000742
Family EGF-type module 0.0061
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|306454|PASA_GEN_0500120
Domain Number - Region: 94-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000121
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|306454|PASA_GEN_0500120
Sequence length 409
Sequence
MHSQLFLVTIILLLVAQWANCGFVNDDGFYFTEDLSDSETLQAVRPSPIECPSEDVIVQR
YRCHDKESDGWKDCFQRSCCQNYTFIAGRCVAADKDPCTLDLCEQKCSVFFGRVICTCFV
GYKFNGENQKNGIRPYCIDIDECDEDNGNCEQECLNTPGSFQCRCGSGFQLREDGRTCQP
ESDTSAAASVVDANSTVTTQLTANNNNETVNETTTLRCQASCEHVTKMEQKMKRLEEKIT
AMSTAIKLYSFASGPPGPEGPPGPEGPPGPRGFPGPNGAPGSPGPIGRPGKSGATQSQAL
EQDDLPLDSYTLIPSGTKDQGPPSKFCRCKRGPIGPAGPIGQIGERGFRGEPGSRGEKGE
PGNFEHLLLLLADLRFDIKALQDKVFVGQSPPLMDLHEAIRLELAATRP
Download sequence
Identical sequences E9FZ21
jgi|Dappu1|306454|PASA_GEN_0500120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]