SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|306550|PASA_GEN_0500242 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|306550|PASA_GEN_0500242
Domain Number 1 Region: 932-1188,1260-1301
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.84e-95
Family Type II chitinase 0.00000348
Further Details:      
 
Domain Number 2 Region: 4-229,299-347
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.49e-90
Family Type II chitinase 0.00000157
Further Details:      
 
Domain Number 3 Region: 406-649,721-771
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.16e-79
Family Type II chitinase 0.00000297
Further Details:      
 
Domain Number 4 Region: 1188-1259
Classification Level Classification E-value
Superfamily Chitinase insertion domain 6.11e-22
Family Chitinase insertion domain 0.00038
Further Details:      
 
Domain Number 5 Region: 229-298
Classification Level Classification E-value
Superfamily Chitinase insertion domain 1.68e-20
Family Chitinase insertion domain 0.00029
Further Details:      
 
Domain Number 6 Region: 834-897
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000022
Family Tachycitin 0.0077
Further Details:      
 
Domain Number 7 Region: 649-720
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000000916
Family Chitinase insertion domain 0.00034
Further Details:      
 
Domain Number 8 Region: 1344-1399
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000418
Family Tachycitin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|306550|PASA_GEN_0500242
Sequence length 1402
Sequence
MTTSPADVDPFGCTHVIYSFLGLDKTSLTVTILDPDYEVVRGGFRAALALKNINPALKVM
IAIGGWSEGGKQYSQMVSSPASRAKFIDSVVVFMEKWKFDGFDLDWEYPGATDRDGRWAD
KENFALLVEEMSAVFQPRNWLLTAAVPAATFRINEGYDVPRLAKSLDFINVMTYDLHGTW
DNYADHHAPLRKRPFDSGATQNLHSDGALSYWISKGAPARKIIFGIPFYGRNFRLANPNN
SKPKAPIAGAGTVGPFTKEAGFVAYFEICRWLQEGGWQELEDEAGSPYLVKGDQWIGYDT
VESVLTKMDYIKSTGLGGAMIWAVGLDDIKGDCGPERPLLRAINDGLRRNGGSTPSATAA
PPKPTTARPTTAATPRPTTAAPLPQPPTTSFAFKTADRQVQTNKDYKVVCYYSSWAWLRR
GDAEFVPENVLSSSCTHVLYAYAGLDPKTLLLKSNDIWTDISNRMYARINGLKQTNPNLK
VMLVMGGWTDSGDDSYSRLVADARSRSMFAAHAAGFLQVYGFDGLHLDWQYPVCWQADCS
KGPAIDRTNYPIFIRELQQEFAKSNLLLGVNVASYKNLAMTAFDGAALGRSADFITVPAF
DFHGSWESVTGHTAPLQGSGDSDSVEASMNYWSRQGIPAAKLILGIPLYGQSFTLAVPAT
TRDQAAIGVKAKGAGLPGPYTQQAGMLAYYEICNEVRQGIWSEVANDAPYAFRGTQWVGY
DNVASVRRKASYIQREGFGGAMVFSIDMDDFRNTCCSEAFPLTKAIARILGIRNDPQPTP
GSNCGRPPGPPTTRPTTRPPTRPSTRPPTQPTTRPTTRPPTPSTPRPTQPTQGPAQSDCV
NGQYYPVPGDCSSFARCVNGVLKKSKCSPGLYWNADETLCDWPEKVNCPTAQPIASVTTP
RPTRPTTTVRPTRPTTTATRPSKPSATPARPTKPSKPGEYKVICYYTNWSWYRPGEAKYA
PSDVDVDLCTHILYGFATLDPTQLTMRVFDSWSDTDEYGPKLYAKVVALKKNGIKVLIAL
GGWNDSLGNKYSRMVNDPSSRKRFIDNAIVFIEKYGFDGLDLDWEYPKCWQVDCNAGPAS
DKQGFAALVSELRAEFTPRGWLLSSAVSPSKTVIDNAYDVPSLSRDFDWIGVMTYDYHGH
WDKKTGHVAPLSVHSEADVVYFNTNYTLNYWIKLGADPAKLILGVPLYGQSFTLENPNNN
GLNAPAKGTGQAGEFTRQAGFLAYYEICKQVKNSGWTIVQDSEEAMGPYAYRGDQWVSFD
DVDIIRRKSELVRTMKLGGAMIWALDLDDFRNRCGCETYPLLKTINRVLRNYPSSGETCA
NSPLIYSGSDNNESSESVSIWAPISGKGTGCSNGSFRAHESECTSYYQCVNGQWAEARCP
GGLLWNRSYCDWSFNTECGRTA
Download sequence
Identical sequences E9FYT4
jgi|Dappu1|306550|PASA_GEN_0500242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]