SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|306626|PASA_GEN_5100019 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|306626|PASA_GEN_5100019
Domain Number 1 Region: 178-225
Classification Level Classification E-value
Superfamily HMG-box 0.00000195
Family HMG-box 0.0083
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|306626|PASA_GEN_5100019
Domain Number - Region: 107-167
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0209
Family Di-heme elbow motif 0.077
Further Details:      
 
Domain Number - Region: 82-117
Classification Level Classification E-value
Superfamily Glycosyl hydrolases family 6, cellulases 0.0602
Family Glycosyl hydrolases family 6, cellulases 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|306626|PASA_GEN_5100019
Sequence length 233
Sequence
MKNFRKTRDELTNRLFQMFNKDIFNNFFHPDFSITWNGRLTRTAGYCRHFTKRENGIITF
ESRIELSVKVVDTPCRLRDTLIHELCHAATWIIDNCRGGHGPVWRKWANQALHTFPELPP
ITRCHNYEISYKFYYNCVSCKYSIGRHSKSIDTSTHVCPVCRGQLQLSKEPSSRVNENAE
VKPKDKTPRTPNAFALFVKDNYAAIKSSRTDLPHAAVMKLLSAKFAESKLKLV
Download sequence
Identical sequences E9GXM5
jgi|Dappu1|306626|PASA_GEN_5100019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]