SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|306810|PASA_GEN_5300086 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|306810|PASA_GEN_5300086
Domain Number 1 Region: 148-281
Classification Level Classification E-value
Superfamily C-type lectin-like 7.76e-27
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 2 Region: 2-136
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.69e-26
Family Fucose binding lectin 0.0023
Further Details:      
 
Domain Number 3 Region: 280-348
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.52e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 337-408
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000011
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 5 Region: 392-457
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000144
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|306810|PASA_GEN_5300086
Sequence length 783
Sequence
MQSSVAGGGVPERAVDGSTSNFFTPETCSLTEVERAPWWYVNLLEPYMVQLVRLDFGKPC
CEDGKPATIVVRVGNSRPDMGVNAVCNRFTGFIEEGRPLFLPCNPPMAGAFVSVHLEGPA
GNSLSICEAFVYTDQALPIERCPQFRDQEPGSSATYNGKCYLFHDNQPLNFNEARQFCEA
RGGSLIDETNPALQGFVSWELWRRHSRNDPSGQYWLGLMRDTADRSNWKWLSGKDVSVSF
WNLPGGGENCARYDGTKGWLWSDTNCNRKLFFICQHRPKSCGRPEQPANGTVIADNFNVG
NRVEYRCDPGHMAVGPTFRTCLSSGFFGEYPPVCKYVQCGMPARIPNGGYLLVNDTRHYL
SMTSYSCNDGYQIIGRGDLVCDIDGRWNGPPPRCEPVYCLEPPIINNGGFRLSTNSTVAG
TVVEYYCLSNSRYRMSGPSRLVCQSDGHYDRDPPVCIGITTSTTTPAPTTRSTSYATARP
TKATKVESTVRSTTTVRSRSTTPISMPTVPTRRPFDPTRLTKLNNRPTGTSNSRAGVFNN
DNNRVKPDVALNVPNGPVYLSPQDNEIADSSNVKNNVPPNVNEPQNTVESDSQGFTPKLN
LGKLNINDSVFPFDYIINIVFWFSGGIIALGVFGGFVFLSAIITTFVIVLRRIRNDKRYR
RRGASSETQTAATFDSSSVDGGAGGTGGAGLSKSYRQAWDNLRDPEQPKRSKSHHHHAQA
SRKETLDDPNYRTRHTEVVREEGEMVVSDVYPKSGGKHHHGEKKRHHHHHHHKHSKRNAS
GDW
Download sequence
Identical sequences E9GYN0
jgi|Dappu1|306810|PASA_GEN_5300086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]