SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|307561|PASA_GEN_6500041 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|307561|PASA_GEN_6500041
Domain Number 1 Region: 2930-3195
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-50
Family YWTD domain 0.00000526
Further Details:      
 
Domain Number 2 Region: 1140-1409
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-50
Family YWTD domain 0.00000256
Further Details:      
 
Domain Number 3 Region: 447-699
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-42
Family YWTD domain 0.0000143
Further Details:      
 
Domain Number 4 Region: 1776-2006
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-41
Family YWTD domain 0.000015
Further Details:      
 
Domain Number 5 Region: 1458-1727
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-41
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 6 Region: 2096-2349
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-41
Family YWTD domain 0.0000188
Further Details:      
 
Domain Number 7 Region: 150-361
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-35
Family YWTD domain 0.0000811
Further Details:      
 
Domain Number 8 Region: 3768-3990
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-32
Family YWTD domain 0.0000913
Further Details:      
 
Domain Number 9 Region: 3277-3317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000327
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 10 Region: 4-75,404-417,696-754
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000121
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 11 Region: 3648-3684
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000114
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 12 Region: 3400-3440
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000119
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 3448-3485
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 14 Region: 2435-2477
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000772
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 2877-2921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000859
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 16 Region: 2802-2841
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 17 Region: 3525-3562
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 18 Region: 3601-3643
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 3564-3602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 20 Region: 2622-2657
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 21 Region: 879-920
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 22 Region: 3483-3523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 23 Region: 2753-2790
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 24 Region: 2476-2511
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000668
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 25 Region: 2398-2437
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 26 Region: 796-837
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 27 Region: 3364-3399
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 28 Region: 966-1007
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 2661-2698
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 30 Region: 2529-2560
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 31 Region: 2713-2749
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000124
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 32 Region: 754-790
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 33 Region: 1414-1470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000148
Family EGF-type module 0.016
Further Details:      
 
Domain Number 34 Region: 3241-3278
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 35 Region: 1012-1049
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000785
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 36 Region: 4123-4165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000346
Family EGF-type module 0.022
Further Details:      
 
Domain Number 37 Region: 2578-2619
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 38 Region: 4383-4419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000621
Family EGF-type module 0.025
Further Details:      
 
Domain Number 39 Region: 3316-3362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000969
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 40 Region: 4289-4321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000101
Family EGF-type module 0.017
Further Details:      
 
Domain Number 41 Region: 1727-1778
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000128
Family EGF-like domain of nidogen-1 0.082
Further Details:      
 
Domain Number 42 Region: 1101-1137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family EGF-type module 0.035
Further Details:      
 
Domain Number 43 Region: 841-878
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000196
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 44 Region: 2041-2089
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000211
Family EGF-type module 0.012
Further Details:      
 
Domain Number 45 Region: 2843-2876
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000033
Family EGF-type module 0.015
Further Details:      
 
Domain Number 46 Region: 4165-4197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00004
Family EGF-type module 0.026
Further Details:      
 
Domain Number 47 Region: 922-960
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000877
Family LDL receptor-like module 0.0036
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|307561|PASA_GEN_6500041
Domain Number - Region: 3204-3258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000129
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 4240-4381
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00022
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 3688-3718
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000867
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 1059-1101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00188
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 4088-4120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0122
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|307561|PASA_GEN_6500041
Sequence length 4592
Sequence
MTQCQGAGCQHGCKPSADGPLCFCKEGSQPNGTDCVDADECAVEGSCDQLCTNSNGSFSC
DCVGGYQKDGQRCHALNEPENELASLLLVTSIDVRHVHLNGTPINGASRHATVETQVSTT
LEFNHRNRTVCWLYHLVPMVVLRCALVADLTVSWDLPPPTMFSLNTVSQVALDWVSGNWY
FLDDNKELIFLCNSTLTICTTVVEVNLNKPRALALDPPNGFMFFTVFGYNSPRIERAGLD
GSNRQSVVSDKVVYPVGLALDLANSYIYWIDTYLDVIERASYDGTKRETVKKGYLVRTMI
KYSGVRNLYGISLFENDLYVTNWRNESVYRINKYTGESVLALKSNKSRPFSIHAYHRQRQ
PEGINPPCKLTNNNCQHLCVPLGKNGNTTQGGNATAAQGNAVCMCKAGYKSVKDGRCTPI
KQAQFLVYAQGKPSMIKSVGLTPSWHQQAMVPITEVGLVGAHDFHVASQSIYFSDRLRLT
IERQKIDGSSRQVLLEQGLDSCQGLAIDWMSRNIYWTDEGRGAISVSRLDSLEEANLSKR
RLLISVPHPRSIVVDPKRGLMYWSQWESVVQVSVLDINTPATIQRAWMDGTHIEVLVRQN
LHWPNGLTIDYAGKKMYWCDVHLGRIERINLDGTNRELIASASENLHRPYGLALSDSFLY
WTEKDAGKIQRLSLNNLSLPIETLRTENRVLFDIKLFDNTSQTGQTTLNISFSNPCPDLC
VVVPKGHVCLCREGFQSDPKNNQSCTIPTAELTTCDPIQEFRCRRSGTCIEKRFLCDGDF
DCPDQSDEDTAPGGSCEHVTCRKDQFKCRTIGCVARSWVCDGDRDCNDGSDEEESLCQNS
SCNTNQFTCRQTGRCIPKAWECDSDHDCGAGDTSDEHDGCANQKCGVDEFTCASEMCVPL
DFVCDRDDDCRDGSDEKNCQHMCESPEHYYCAADNKCLSAAALCNGVVECSTREDESNCS
AVSKHGCESHEYDCGDGTCIPSLLVCNLQHDCLDGSDEHGCVNVTCRPGEFTPTCLHPSR
LCDNQTRCIDASLLCNGKADCTDGSDESDRCSEKLCSHAHDCSHVCHNAPEGVVCSCPLD
SGLTLGNDSKTCSISHPCEQWGTCSQLCIPVRSKHHCACFPGYEKQPDGFTCKSTDPSTP
YIIFSNRHELRGIDLHTHNVKALISSLKNTIALDFYHSSEADVIFWTDVVDDKIYRGTLV
GGSLTNIEVVVQTGLATAEGLAVDWIGENLYWVESNLDQIEVAKLNGSFRRTLIAGNMES
PRAIALDPRHGILFWTDWESGHPRIESCSMSGDGRKVVVRVDAVSDGAWPNGLTLDYGAE
RIYWIDARSDSIHTAKYDGTDPREIIRGHETLSHPFAIALFENHVYWTDWRTNSVIRANK
WNGSDVTVIQRTLTQPFDIQILHPSRQPSDFKNPCGTKNGNCSHLCLLNFNGTYRCHCPH
VMKLAEDGRSCIRNERVLLFSRPNEIRGVDLDNPYYHIIPPISLPQVLQAVQLDFYGQER
RIFWVDAQLNEVKRVGLVGSPIETVIDTAIKNPHGMAIDWLSRNLFFSSSDGTRNHISVC
SLDGEYVTRIIEEDVYQVRSMAVDPTQGKLFWSETGRPQQQEHLIFMANMDGSERTILAK
LTYHSEDSPKSLTFDVQDKRLYWIDVESQSIQYYNFATQKVVQLSSNLTTLKLPTSLAVL
GDQIYCADKDDAAIHVIDKTVGTHDSILRTNIDNVLALKIYDPELQTGTNECMSKRNQCA
HLCLPIATSKFICKCAAGYVTDPKNPNNCVSVDSFILYSLNGEIKGVALGETVNVTNHTE
VLGPISRIQMANSIDFLAVDGYIYWVDSDHGSIVRIRRDGTGRQVIAQGLDSVEGLAIDW
IAGNMYWTNPKFDVIEVANVNGSFKYVVVAGDMDKPMAIAVDPVAGFLFWTDRGRTPRIE
RVRLDGSDRRVLVNESIFFTTGLTLDYQNKKVYWCDSRLDTIESMDYDGGNRQVLLDKTH
LENPQGISVYRDQIFWIDTTQDGGTLNQAPTSNVSDHQVVLSQLGESLKDIKVYSKERQE
GTNPCSIHNGDCKELCLFNGSSAVCACAHGQVSADGRDCEEFDAFVVYSRMTRIDSIHIS
DANNFNAPFPSIESKEFIRNVIGLGYDYQRRLIFYSDIQRGSINSVYFNGTRHKVIAEKQ
GMVEGLAYDSKDDSLYWTCNSDSTISKAVLSHKNATVEKVVRLTTEDKPRGIALDPCDSR
VYWTNWNSRNPGIQRAYYTGFDVQSIITTDIRMPNALALDLVAQKLYWSDARLDKMERAD
LDGKNRVVLSKVSPQHPFDIAVYGNYIFWTDWVLHAVLRANKYTGEDVVWLRKEVPRPMG
IVAVHNTTYDCSANPCRALNGGCEDLCRLDEYGKVSCQCFPGRTVLRSDPSRCGRQSTNC
SAMEFECSSGDCIPFHFTCDGVAECPDFSDELPTYCMFRKCLPGFFQCQNSRCVLQNASC
DGQNDCGDFSDEANCTCSTSQFRCTSGHCISNSFRCDTDPDCPDASDEMGCPQPNCTLTV
NAPAQKLQNCRNTTACIHPSWICDGANDCWDNSDELNCTSPGSTTGPSGGPSVTDGQSCP
TSAFQCRNGKCITHAWLCDRDDDCEDSVNGTLSSDEVNCDYTCRPDQFKCNNSDCIPSMW
RCDGTEDCTDGSDESGDCQTRVCGETEFRCNTTGRCIPSLWVCDGDVDCSEDGSDENPSV
GCSPNLSPDKSRPACHHNEFRCINRRCVLKLFYCDGDDDCGDLSDEPPYCAHVSKHHCAP
NEFQCRNRKCITRSKTCDGRDDCDDGSDEDVISCSMSSNTNTTKGECLAGQFRCANRLCV
NSALLCDGRNDCGDFSDENKCNVNECEPINPCAHTCVDKPVGFECQCNEGYKTNPKDPLL
CADVDECALHPRPCSQICRNTIGSYICSCTDGFAIHNGTGCKTNSSIAPTVLFSNRYYIR
EVHLHSRVASVRAHNLTNAVALDYDWLEQCLYWSDVTEYGSSLKRLCGNDTSQDQQQTLH
SATLQNPDGLAVDWVGRNLYWCDKKTDTIEVSKLDGRFRKILLHEGLQEPRAIALDPSQG
YLYWTDWGDKAHIGKVGLDGSQPRVIVNTSLGWPNALAISYETNEVFWADAREDYIAVAD
LEGRNPRIVLSRGDNTNARLHHIFALTVFEDSIYWTDWETKSVEKCHKYNGGDRETIITT
IHRPMDIQVYHPLRQRPLEKNPCQNNGNCTALCLLKPGGGSQCACPENFVLASDGVSCLN
NCSSSQFVCATTYKCIPFWWKCDTQDDCGDRSDEPADCPAFTCMPGQFQCSNGHCIHPSL
LCNGESDCGDGSDEIKCETHTCLSSQFKCRGNGTLSDRCIDSNQRCDDQADCPLGEDEKD
CPPVTCPSNQHRCGTDSKCIPAVWVCDADHDCPDGSDEPANCTQRACPDNHFRCRSGRCI
PLTWKCDGDKDCPEGEDEPDSCTNPDIHTCEPTYFKCENNKCIPGRWRCDYDNDCGDGSD
EKGCTPRNCSESEFRCGDGRCIRGSLRCNGEFNCDDRSDEAGCNTTCSEGEFQCANPKFC
IQADWRCDGDVDCADGSDEFHCNTTCSPDDFACANGECTSLLWRCDGDNDCSDGSDEARD
MCAHLGCPPGKFRCRNFLCIPQTEVCDNYKDCEDGSDEEPAVCQAQGLCLPHQFRCRSGH
CINGSMACDGFNDCGDGSDEIDCRSPSVCSFGKCSQLCVEKKGGNHSCICAPGFAAMSTG
ANKPKTCLADGDASQLLIASDNKLRRLSPFKAGDISDSVFSPGSIRIEAADVFYNATELI
VFWSSPHNKSIHRYDMAASTLHQSSNLEDTQISSRRGKTETLLTGLEDPRGLAVDWFGFN
LYWVDGTHKLVGVISFDGLLRRHLISSDLDQPHDIVVDPLSGSMFWSDLGLNARIETARM
DGSLRRLLVDSDILYPTGLAIDYPARRLYWADPKTGTLESVNLEGKDRVVVRRFRLSIED
KPFKVDIFEDSMFLVMHQTHGIARLNKFGQGIDSIYSFLFIQWTSQLFENYNVAGNLTTL
VSGLNRASDIIVVQENKQTRQSSNPCSTKCNPGALCLLSSSTSRTCSCTMSMTTTMVGTD
VTCQPPVCGLDCNSGKCVVDDRGMASCKCPSLYEGDRCERYRCSGYCRNKGVCYPDLLVS
DPPPLKCSCTPDWTGERCETRATACEDRCQNGGSCIQTASGTSCSCPSGFSGEFCENCPS
LNCLHGAFCRAIEKETKNKEKENRDKNSENDKERKFVCSCPPGFSGDRCERSECDDYCPQ
SECTMNELGVPQCLCAPGFTGKKCDNDVCAEFCLNNGECLRSAKKITCNCKPGYTGRRCE
TRSECTDPSQCPAGTSNAISTVCNGFDCLNGGLCVAIRGQAFCRCSDDWAGLHCEDYRGD
YNACKAMCINGGVCVSTKALSVPRCECLADWTGPRCQYRKSCLNYCFNGGTCSLNPDEDL
KPTCLDLNNSSSQSTSGKSSVNGTITAIVVVLVIIVVIIAAAIAAVTVMRKRRRGKPFMH
VRMQSQENVEISNPMYLREDADEDVESLDPTFVIASNKATNFANPVYESMYNDVAAGSSV
NEEKKGLLQSEPPHPLEPHKDHPLAENGESFT
Download sequence
Identical sequences E9H319
jgi|Dappu1|307561|PASA_GEN_6500041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]