SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|307580|PASA_GEN_6600009 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|307580|PASA_GEN_6600009
Domain Number 1 Region: 29-89
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 2.43e-18
Family Tachycitin 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|307580|PASA_GEN_6600009
Sequence length 93
Sequence
MFLRCLLITLVTAAFLKRMQATEMDSQETDGRVSVCPEDGVYPNYYNCSTFITCSNGIQY
LMACPEGLIWNVDTSECDWPNNTECVTYPAMSI
Download sequence
Identical sequences jgi|Dappu1|307580|PASA_GEN_6600009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]