SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|307880|PASA_GEN_0700185 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|307880|PASA_GEN_0700185
Domain Number 1 Region: 1477-1530
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000154
Family Tachycitin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|307880|PASA_GEN_0700185
Sequence length 1551
Sequence
MARYIALGVWFITGIAVFLFLFASAQELDSNVQDQLDSAEENRQSGPGLQQSANINRRRA
GGTIKYKKISVMKSGSAFEKPGLFEVPDLGPNKTRRLKPKTSNRHTMIYRPTKKSFPSPK
KESLGLSTAQTTPPPEVKVQRLPDSGRNYGTKSWQQVQPVTEVINSFIRPTKRNRVRVNN
RPSNDITASLTTPAPKVTLDPLRPISRVRSGSSITTTTTSAPTTTKFLRLSRKPNRWQSN
VSNNKKHQQQPAKHHGTDNSELPSSAIPTTTTESTTVARVSSSPKVNVIQLTEATVISDA
SNKDEAPESAEIEHVKEESAIRKIAAKPDKIAYFDMSESLSRPKDSSQEQQRTTRPRLHV
PKKDSTNYESQRESNKEPILLQTKEQREQQQQEEQQLEKNEDALHQQPEVSVQFPRVRQR
LPQPESNSPQPFATVEETEKRLEKYEAEKNKQLDRLRQSKIPDAVIQFGAEESPRARIVP
SRAEYQNGPVRINSPAPLNEKEESVLDFTRVPPSEFGQRLPPGQNSLPQSDSRPAYYEFE
AAYPAPGKVEQQRYIYNPSAGTKSNSNQERYRPETEYSTTPRPNHDSNRRPEVIYIHTTP
RPEEEKYLRPEVIYTSRPNANEDRRPEVIYTTLRPIVPKEDRRPDVIYQTTTRPIVSDEK
QRRPEIIYTPPEHEYQPPSAYLASHQGTYPRVRIAYQPAPSTIPPPPVTYEPPHLEFMPP
SASPPPRIYVPPVEEYKPPATTAAVVFQGLRPEEKTPSVVHSQRFEDPRASEGLRKLEAI
NSYTRLVSVGHPSVKQLPYPPERDGPTSGSSRPVQQPEPIVITVTENPYRSYERNRGGNE
KGERYQEKPYVLHGNYQRDPAAGKSHMVESAYIIGSATPVVHHERPRPTFEGSSLIVGKP
YPIKDEGPVQIHVATYASYERPKSESLILERPVYSSPSVEINTGRRFPDPPPTSERPSYQ
QSHQLHQPSNQPYQSYPSDQSYQSYPSQQSYRPDLSQQSYQVEQSHPSHRPDPSHPSYQP
DQFHQSYQSNQPSQAYQSQQPINQYNQQPLLQSKEPRKLNFPPSASERPYVIHLPAGRDV
IEVIDNRYENVIPVSEQPQHKHYGPPAADEEIVVRTERPPQEIRYVVTEKPITVTVRPHG
VPSPESEIAYQSQLTSDQSSLLMSMSETKTNMAKNQQLTIQDQQTRPAAADVQSDEQKPQ
HHQQPEFHQSNVPASFYPVGPVRAYQVTHAVYPSPPPRFFQLPGPLPNPFEDQFPASTPS
STPPPPTPPPTTPPPPTTPPGRQHQPSSFAENHLPKGDTWAVNPLFQNQDQFPSSRPFAS
SIQPLITEESPHSSEKVVRYRPASFYHDNDRLNRSLAYHTVPSHQPQLLHDSPIVIHETY
RVRAEDLTYHQPPPGNYNEPTPISKQIFNRPQENPSHLQPTPVYYNNQPQDSYDHQQQSE
QDFSGVEGTPGVDYPILHSVPHDLKFKCELVDSPSTRHPAYYADPYTRCQVFHVCQSNRA
KNSFLCPNGTIFNQKVRVCDWWHNVQCDESSAYYNVNTDDENNYQFKLSSH
Download sequence
Identical sequences E9G129
jgi|Dappu1|307880|PASA_GEN_0700185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]