SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|308138|PASA_GEN_7500047 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|308138|PASA_GEN_7500047
Domain Number 1 Region: 252-508
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-42
Family YWTD domain 0.00000891
Further Details:      
 
Domain Number 2 Region: 582-789
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-27
Family YWTD domain 0.00049
Further Details:      
 
Domain Number 3 Region: 1327-1554
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-20
Family YWTD domain 0.00069
Further Details:      
 
Domain Number 4 Region: 1200-1303
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 39-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 906-942
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 196-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000549
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 3-32
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 9 Region: 991-1029
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 948-986
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 11 Region: 1132-1171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 12 Region: 84-120
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000011
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 13 Region: 513-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000399
Family EGF-type module 0.012
Further Details:      
 
Domain Number 14 Region: 826-866
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000227
Family EGF-type module 0.016
Further Details:      
 
Domain Number 15 Region: 869-901
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|308138|PASA_GEN_7500047
Domain Number - Region: 127-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000288
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number - Region: 1037-1073
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000367
Family LDL receptor-like module 0.0049
Further Details:      
 
Domain Number - Region: 1089-1126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000576
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number - Region: 1572-1601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000803
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 168-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00652
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|308138|PASA_GEN_7500047
Sequence length 1788
Sequence
MKQCKDGHCIAMFFFCDRENDCGDWSDELNCTGMSSGLTLNCPSNTFHCEGQVCIPQNWV
CDGMDDCSDARDELHCNKTTECKNGFQCGKECILNQWVCDGVTDCADGSDEKECGPEAFM
NHSCLPEHGWFSCLSKGTQKCMPISRACDGYADCDDRADEGGQCNSTSNCSNSTRCPNEC
HKTPRGPICSCPSGYQLNGTTCVDIDECSMDPPMCSQKCANNQGGFECSCSSGYTVGTRD
KRSCIANGPEPMLLITTDRDIRYISLPSKEYGLVQSGISQAHGVAADYEDGFVYWNEKSK
DKAGIYKSMLDGSAFQYVVSVGVEMVEDLAIDWVGRHIYFADSGRKHVVVCDFHATICSI
VISGQLEKPRAVAVYPEEGLLFWSDWGSSPHIGSAGMDGSQRTNVITKDIIWPNGLVVDE
TIQRIYWGDAKLNRIESSKIDGSDRKILPVKVTHPYALDIFENNIFWCDPLEHEVLSVNK
FTGKDYKILIKESSLTPTGIHVHHPSKQSHLTDPCRNVICSHLCLLSPTVQGYKCSCPVG
MTLNKDGRTCESISAHESSIVIATFSDIYRLTHHQIGKDSILRLPTRNVDNIGALAYNPL
GHSIVYSDMIQRTIYSMHLDTYRQTVLFENVDMVEGLDVDPFTENIYWTEVTRGTVVVGQ
KNHDGVYERLVLARDLYSPQGITIGSQSGRMFIVEGRISHVISVWHMDGTNRQELVQVYG
TVSAMAYDGKHLYFSDSLRGTIERIEVNGENRTILRSHLGTPVAMDASSDSVFWLTQSST
RISWLNKQETKTMRGFVIDASDDINVQYRLMSVIDLFDFDSHDHHCLGHTGGCSDICAPT
PDGVTCLCPLGKVLGEDKHVCTTADCVGDEWFKCQTNCIPAKFRCDGVNDCTLGEDELQC
RNTTTEVGCTSSQFQCKNGGCVSIHFYCDGDADCQDRSDEPDSCPPYVCLGEGEYSCPNQ
HHCIPRSAVCDGQADCIDKSDEANCSSTHSMCSSTQFYCSHSHICIPLTWVCDRDSDCQH
GEDEDSSVCDSVVNKAPCPLNYLRCPQRPDCMPRMALCNSIAECEHGTDAELCAKLNDSF
VETETEKPDCLSSQYNCFLGSNECIPIASRCDCRFDCTFGEDEEGCDNLPFSCKKDLFRC
PNEMRYINISWVCDGLSDCSNSADEALLLCPANVSTSSSSSTTITPSCSATDFMCLSGEC
VQASSVCDGKFDCFDGTDEGSGCAKSCQNNGQCPQICVPGPMEPTCLCEPGYESLINGKQ
CVDVDECTFENKCSQFCNNTKGGYRCSCAPGYSLEPDQITCKAASGRPMLIVATNHHVEI
LLNSDIASSRFLVQSVPAIKGIAYHDKMSTLYWITTEGVSRSNSGGQSLIYKINDLIPSG
LALDKATGNIYYCALKNASRTGQDQSVIRVIAKSLEAEVNIITTQSIITDIALDSQKGIL
FWSEHTKPYTGRIVRATMDGRSTMWLYSIDKIMYPTAITVDSIKSRIYWTDITLQSISSC
DYNGLKQRQEIGITNGQPLSITFFENRITWSLRDQDVLYSHVINGSTTSQHKLHEKVTHI
VTVHSLLEPELPNHCAFSPCNNGICVLKNSSSFTCHCPIGVTVVTSNPFKCSGKSPEVVT
ITPSSEFGINPDFVETPSSPGVTVASILICLAVLTILAILGWVYYRRWRRTIGSPLKFRF
RNALGLTEESTAWEESVDYGDRKRLFIKSDESDDHGCGPQVMVDQNDNRTTVTATPGGTR
RFPTDSAYTNLPSIQQSLGKSHTTEDHQPQQLLPATYSMQDQLLASEL
Download sequence
Identical sequences E9H6F1
jgi|Dappu1|308138|PASA_GEN_7500047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]