SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|309115|PASA_GEN_0900185 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|309115|PASA_GEN_0900185
Domain Number 1 Region: 302-603
Classification Level Classification E-value
Superfamily Kelch motif 8.24e-42
Family Kelch motif 0.0022
Further Details:      
 
Domain Number 2 Region: 82-203
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-18
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 3 Region: 898-946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000711
Family Laminin-type module 0.037
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|309115|PASA_GEN_0900185
Domain Number - Region: 209-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family Integrin beta EGF-like domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|309115|PASA_GEN_0900185
Sequence length 1336
Sequence
MELQSSFISAVEFYKYRRKHSIAALYLVCLGLLIATQTSKAEEVYQCDNHTQTCISESEF
GEQNDQQLFNIPSPLPTWAEIPQCRGKILLNRPFGFLSDGPSNYSLDTKCAWIVQSSVPN
ATISLQLIEFATECSWDHLYVYDGDSVFSSLLAVYSGLTIYGNYKVEELNQITSTSNTIL
LYFYSDLAYNMSGFNISYSINSCPFNEEGKRCSGHGVCIGTTCTCDADFYGHSCQYAVCP
NNCSKHGVCNMETHSCVCDEGWSGLDCNQTRDRGFWTSVWEFNGTRDERLARTQSSGSVW
KGILWVVGGHGLDLKLPLTMAFNISGNDWSRVETNGLFIPTLRHGHSTLIHEGVLYMYGG
VTHDGSVSSQLWSLDLSTKEWILVAPSKNKECHHRLCGPVATTGHTAVLVKDKMYVIFGY
NPIYGYLNILQEYSIDSRQWNVVSSSGALVQGSYGHSSVWDPLTKRIYVYGGYQSESSSA
YGLTDALHSYDPALRVWRVHPSSGSYRYLHSAIMSGGLMLVYGGNTHNETAISNGAKCYS
SDFIAYDTVCDTWFKLNQPAATSVGGDLSRYGHLAASFDLNDSDEYHQPLLPYGMLIFGG
FDGRLKSDVLVYIVGICTSLATKEQCLTAMPGVKCVWNKAAKKCEPLASVSKEGYEKCPE
SPNSQTEWSSSASAIGYAINSTLQCGSISSCPTCLHTTFNCVWCGHNCQYAKCKEGLTHT
KAIPSLEHCQVADANSCRLLHSCSACHTEPHCHWEPDARCYSYVRKKVDVKEDQVCDAAC
SLRTNCRNCTQGPCLWCSNQNRCVDKNAYIPSFPYGLCTEWTTHENKCRDLDFPQLEDGG
SSGQRNDPACGWCDDGSNRGTGTCMPGGFSGPVTNVLNFRTELVCPSQQWFFTSCPPCQC
NGHSTCIEGTQKCNQPCLHLTEGPHCETCTSGYFGNPVNGGTCSPCQCSGHGTQCHPLTG
RCFCTTKGVVGDHCERCDLANHYSPGLLTVSSHANTNSGVPANWTVLPTCYYDLQLDFQF
TFNLSKKEDRHIKQINFRNVPLKPDLDLEFSVQCSTLAKLNISVRSAKVYILFNYNCTTF
KSRFQRNEYHFGSEENTTFYVYVYDFRSPIQITVSFSQHPKLELQQFFITFSACFISLLM
MAAILWKIKQKYDMYRRRQRLFVEMEQMASRPFSHVLVELQVPPNFPRRAPVPNNRCTSV
ESRSQGVTVVGTQSGSMNQHIIETSLCNNVTPAPSSSSSHSSAVTSNAVRRRRRFRPSPI
ALEPCVDQKAAVLSLLIRLPNGTLPYTPPGQSGLAIASTLVSLGSYSSRKNNISESREMP
RSLPKAKTPPTLSQLA
Download sequence
Identical sequences E9G3Z6
jgi|Dappu1|309115|PASA_GEN_0900185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]