SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|309818|NCBI_GNO_0100349 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|309818|NCBI_GNO_0100349
Domain Number 1 Region: 271-430
Classification Level Classification E-value
Superfamily vWA-like 7.09e-24
Family Integrin A (or I) domain 0.028
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|309818|NCBI_GNO_0100349
Domain Number - Region: 712-795
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000235
Family Complement components 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|309818|NCBI_GNO_0100349
Sequence length 828
Sequence
MSRCGLLIECADREHIQLPLTGVSVVAEIIDLVAKVSIEQRYVNRENHPIEAIYLFPVDE
GAGVCHFTAEVDGRSIEGVVKETEEARNDYEQAIQSGHSAFLVEEKLPDVFKAKVGNLAA
GSGAKIRLTYVTELKVEGGEIRFYLPTTIAPRYVPPTDLSSATAELASINYTQTNQYQVE
INVTVQTASIIQKIYSPTHKIDVNHNVGDNPMKAKLQLFEKVSCMDRDFVIYVEVAEPHQ
PRLIHEKSKNGTSALMLSLVPSFKLDEMKIEAIFVVDRSGSMQGPGIVEAKRALKLFLHS
LPIDCCVNIVGFGSTYKPLFSSSRKYGHECLALTKECAQFLEADLGGTEIYDPLAWIFEQ
PTINGYSRQVFVLTDGEVSNVNKVISLVRCQRGNARVFALGLGSSASHYLVEGIARAGNG
TALFASLDERLEKKVMQQLQDALQPALTDIKINWQGYDETEQLSSPFNPPIQTEKTLMGY
GKSREEPVTPAISENPEMKLRQAPSDKMIPPVFDGRHFIVYALIAQGAHIPEWVEVVASA
PVGPLLLKVNRTKPNFEESQLIHRLAAKKLIQVLQERGDDLTNKNEIIQLGCQYGLASRY
TSYVAVDPKEQKELKDSWMVMKSRDIPVQVAHGWGGLSQNFMMTDSASPITKVPRVERCL
LLGDGSSTESPTFMTFSSPLEGRPVSTGHHTNTFETLPHSALLSDDDKCILLISTQNYDG
SFPMEHELAQLLHTKLEIIKQAGEKCCYSETIWATATALAYLSLALPKLKDSWKLAAKKA
EKWIDSHEGFSNREHRKSCIEEAYQFVRCNTSVRSGLKSVTNSIFSFE
Download sequence
Identical sequences E9FQW6
jgi|Dappu1|309818|NCBI_GNO_0100349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]