SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|310287|NCBI_GNO_0200224 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|310287|NCBI_GNO_0200224
Domain Number 1 Region: 641-897
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-55
Family YWTD domain 0.00000952
Further Details:      
 
Domain Number 2 Region: 339-588
Classification Level Classification E-value
Superfamily YWTD domain 1.28e-54
Family YWTD domain 0.00000234
Further Details:      
 
Domain Number 3 Region: 23-289
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-45
Family YWTD domain 0.00000274
Further Details:      
 
Domain Number 4 Region: 951-1205
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-36
Family YWTD domain 0.00018
Further Details:      
 
Domain Number 5 Region: 597-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000251
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 1311-1346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 899-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000733
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 8 Region: 1259-1309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 9 Region: 1346-1378
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000916
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|310287|NCBI_GNO_0200224
Domain Number - Region: 1218-1271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00105
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 294-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00215
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|310287|NCBI_GNO_0200224
Sequence length 1713
Sequence
MRLLVQLLAVFLVTVQQGASAHPWLLFANRKDIRLVDATQTRNRNNNVTIIIKDLEDAAA
LDYHYEKGMVCWTDISLEMIRCAYHQGANLLNKTNVITTGLVSPDGLAIDWLGNKLYWTD
SETNRLEVSTLNGENRKVLFWEDLDQPRAICLFPKKGLLFWTDWGENPKIESAGMNGDLT
TRHVIIKDEIFWPNGLTIDYEEEAIFWADAKLNIICSASLTGANRRTVSQGDLQHPFALT
MYKNVLYWTDWQTKSIHSCNKKTGAGRKAVLGSSLTPMDIHVYDQERQPYSALPCQNQNA
KCSHLCLSAPYPPWFTCACPTGSKLVDNFTCADGAQQLLLLARRTDLRRISLDTPDYTDV
VLPLDGVKHAIAVDYDPVDGYVYWSDDEVRGIRRAKLDGSQQEDVVMAEVDHPDGIAVDW
IGRNLYWTDTGTDRIEVARLNGTWRKVLISENLDEPRALALDPEVGWMFWTDWGKEPKIE
RASMDGSDRVVLVNTSLGWPNGIALDYVQRRLYWCDAKTDKIEVADMDGSKRKEILSENV
PHIFGFSLLGDFLYWTDWQHRSIERVHKWTGEDRKIIVDQLPDLMGLKAINITEVRGTNP
CAVGNGGCSHLCLNRPGKYVCACPIGYELTADEINCVIPEAFLLFTRKEDIRRISLEANH
KNVIIPIAGVKEASALDFDVNDNRIYWTDIGVKSISRAFMNGSNLEVVVEFGLEYPEGMA
VDWVAHNIYWADMGSHRVEVARLDGSSRRVLIWKDLKNPRSIALDPGEGYMYLGVWGSVP
HIERAGLDGSQRITLVNGVGRVNGLVVDFADRRLYWADVDGKHIESCDLDGKQRQVVVSG
NMPQPHGLTQYEEFIYWADWTTRSIERAHKQSGENRTRIQTQVDYVMDILVFHSSRQSGW
NPCAVNNGGCSHLCLALPAGIVRQSHTHRCTCPTHYELVADNKTCVAPKSFLLFSQKNYI
NRLLPSSPDSPDVILPIRGLKQVRGIEFDPVGQHLYWIDGRSQTIRRALDNGTQASVVVA
NPTQSLHPYDLAVEPYSRVLFWSCSRFNAINATRIDNHLSVGILVGGPSTSDKPRNLAVH
PVKGWLFFTNLVSPARIERCRLDGSDRVKIIETDIDQPSALTIDTEEEMIFWADTSLKVI
EVAALDGTNRRKLISSQLVQPIALTVHGRHLYWLEKDSQLIERALKINGEDRQRVQGRIP
YLSDLLSTSTLDPNTLASNPCYPPNSGCGHLCVLMDSGERGRCACPLNMILEDGKTCVEP
PACSPEHFTCRSGIYETGPSGSGATRCIPLSWRCDGQTECSDASDEEDCPECRPDQFRCQ
TGQCIAKKHECDGVPQCMDRSDEQRCCPLGQFYCSELCLPDILLCDGVPHCPDESDESVT
SCANRVANPLAGDSSIRTTYIIGIVVGLGSVALLCVLFFCWHRRHSHADPDEGAHDPLNP
VVPRHTIVPGHTQLQTDYQLQYVSNIVGERTAGVGASSHLGSSAVDLLSGRGVKNGGAII
VDGGGVVVGSSSSCQLYDRSHVTGASSSSSSGPGYPQETLNPPPSPATDTRSHCTEPYCC
TAVSGQSHKSHTLSRQTARGHHLGHQPRLSGTSSQVYSTLRSYKHYKVRNQPPPPTPCST
DNFEESDSQVAYHSSPSPSSIPKMGPGFKNAGRRQQSSHRHQRLGADYDSDPYPPPPTPA
RSHYVSDASCPPSPSTERSYFNPLPPPPSPSPQ
Download sequence
Identical sequences E9FT42
jgi|Dappu1|310287|NCBI_GNO_0200224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]