SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|310333|NCBI_GNO_0200270 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|310333|NCBI_GNO_0200270
Domain Number 1 Region: 311-338,389-435
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000262
Family Spermadhesin, CUB domain 0.0064
Further Details:      
 
Domain Number 2 Region: 36-69
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 1076-1113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000393
Family LDL receptor-like module 0.0044
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|310333|NCBI_GNO_0200270
Domain Number - Region: 498-575
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0196
Family Spermadhesin, CUB domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|310333|NCBI_GNO_0200270
Sequence length 1268
Sequence
MQMTYSGGALIMALLILRFQRGIAQLPSSIGGGGGCPVTQFRCASSGRCVNLNLFCDGRN
DCGDNSDEPAQCTHCNRTYYAGTGESYRLLVAWPKLNQMPFLCYLTFTTATPQDPSQLLQ
VRLDTATIGQYVVQHSQSAGEVNGRCPDGCMQILEGAAGQPALAKLSAASGNNNNNTGNN
NKQMVPGAWCGASITPRFYYAESTSVTFVLHLQTIPQSLLQKSKSLLMVGDTLPSSLSAQ
QLHPILDLTYKALPRASAIVRYGLKLKSSSAHLLGEPVAGTVCSRAFRQCGSSNSSTNKT
SQQQQEEQQCRVQSPGYPGIYPRNAQCVYKISHRPSSSAPSGSRTRRYVIVLWQNDGRKI
NLRDWDQPTRDASGQQQRASRSMAECEASGDYITIYDGSSTQAPVLTRFCDGPLPEVVSS
SADVTVEFRSSALDTIYAASTTIEGFELKVRIVSVESLPFQLPAATTTASSAADSTIISS
SGGSSSSRTIITGTSNNKCQWNVTSSGLSRGQLSSPVQTWPLRTTCHFRFVGRPDERVWI
YFAKYHFEKEKKRQQQQQQQQQQCRNALRIAEGDGFGWDPTSSGVANGTIRLFCRDTKPP
PLCERQLSVLQSNSRDHFVPPPPCLMGESFVSQGSTLSVQQYLPEGTAFSAWKYVLAYEF
FRQSQDGQPLAEVDGWTINKEKTKPLAAADCNRLLSVQGNQPGMELRGSVKSPQNVFLFG
RGGARHLKCVYRFQGEETMRVAVEVTRLRLGGRPGSQCHSRLDPLTHQRRCHILRSDYSP
AAAGGNGSTTTTTSTAFLQLRERPWAGQTAGHNVLLQRDCLCDTAGLQLPFRYVSTGSAV
EVVFQVTGMTHADDYHDFFFEISYEFLGGSPGTSSGMKCASQSELKPLQGPGGIIKLDGL
RGLTLGRQNSVCNRQSWFLLPSRADRFFFLSANGFLMNNQSNGEESGTAIDCPTKNRIVV
YSDRQADGRPLAVICPSLNPEGGVKIFSSTFNAEDAVKSLDLENEDEWRNQSSQDVSGGV
VIEFIAIQSGSYTMKWLELTPQSVLNPFNNKSMLTGVVIPHLGSVSSPPSQQLYPWFFCS
TWCPELKACIDSQLWCDGVYDCPSGVDESDQQCLHSTPTTSNNDNNQPPGTRISSWSVPK
VYWYLIAAGSTLLSLFVVVSSVMVCRNGQHPLKQPGYNDQNNATDPAGLVSSPSQSSPGA
AGGSFRPLPVAALNDYVYQQPDNGIIGSNRSIVVGGPNIKIVGGGGSKSDGINKVPSLYH
YDKKMAVS
Download sequence
Identical sequences E9FTA4
jgi|Dappu1|310333|NCBI_GNO_0200270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]