SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|310489|NCBI_GNO_0200428 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|310489|NCBI_GNO_0200428
Domain Number 1 Region: 79-125
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000392
Family Tachycitin 0.014
Further Details:      
 
Domain Number 2 Region: 783-841
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000392
Family ATI-like 0.053
Further Details:      
 
Domain Number 3 Region: 832-880
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000023
Family Fibronectin type I module 0.087
Further Details:      
 
Domain Number 4 Region: 329-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000349
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|310489|NCBI_GNO_0200428
Domain Number - Region: 229-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00119
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|310489|NCBI_GNO_0200428
Sequence length 929
Sequence
MDPFKCIVTLLSLSLVLAVPQAILDETGASIDLQEPQQDQGGLKGRKIAVEQPQKAERAF
SVGQSMNQGPKRCDPARPHSAHPTNCYMFYHCVDRLTGIEQVEKTCNPPTMFNPDTMVCD
WPESVMRLRPECAFADAASPPARSPATAPSSGLKAPGKLTPNKNAPLYFKGGCTERPPTP
ANANVKCSPNSGNCDVKCLEDFSFPDKSTQMQIRCEAPGIWKVANWDKMPDCEPICMPPC
QNLGFCIAPGVCNCPDNFEGSECQFAKSKPCLDKPPTPMNSRVVCNEKECISTCNRGFTF
PGGSKKLTMICDSGNWIQRQQQPGTFQKVPDCQPVCDPPCANGGRCLPNNFCECPQEFRG
PQCNYPVENCAPERMNFNGGYNCSGGSASFSCSLNCGADGVFEFPPAPRYTCEYAKAQFV
PDPIPQCIFASQQVQYFKSNSTSHSQMLIEQSSELEWNGQKTVKEETEWSLIPGKGVWSK
KQYEKYFENFFSGGSNGEYVINIPEDSLVRETAARPGTCLTWGGAHYKTFDGKVYSVHSD
CSYVMLRDAVASTFSVIYGVHKCPSNSNCKRFVNVLVEDFTYEIDTNANGVPYVRKGDQS
LTLPNQVDGLLFERVANFVIVQAEGLGFTVKWDTKTTVTIDVNHALWNRTAGLCGRINGM
WVDDFENRDGTRGSSLLGFVNSWEASGLTDQCLSNPNEKHACKWDTPQDQQVSNEATQMC
EHILKDEKFEKCRKVVDPRSYYEACRWDYCQCSNSNREDCACSALETYFHECLRHNVELP
DAIDCQNGRVYKMCGPISDETCSSPVTAEPVRPTDLCIEGCYCPKDSALHKDQCIPRSEC
PCTLRQKTYQPGEQVPNDCNTCTCVAGEWQCTDIRCGSRCAVLGDPHYTTFDGHHYDFMG
KCSYYLMKGDNYSVEAENVPCSGAISQVG
Download sequence
Identical sequences E9FTU3
jgi|Dappu1|310489|NCBI_GNO_0200428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]