SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|311054|NCBI_GNO_0300407 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|311054|NCBI_GNO_0300407
Domain Number - Region: 340-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000221
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|311054|NCBI_GNO_0300407
Sequence length 605
Sequence
MDTINGNKLSKSNMTVLSNSYWILMFSCLFILAGQLLFVKSDVIQEFLPRGVSAYGDGLE
NGQLLHIPLGDVNQSLLFTYFANVTKGCSWTNVTLFLRHDGLPIVNVFNASYPNFTWVYQ
PIDYEENFLGDGLQQRLTIHPRQPSSVIFGVVFFLEDAARIQQQGLTKSCTTLFWGRVET
LPLNVSSISVDRVDETAAKLVRKNYVQPLSAKWVLDHNKGDDNISANTESILDLKSSDIP
TFLSWTILSPTDIGGTLQVDIKFNQDERNSSVFGYLAFGTQENPNRTQFSANSSEVIPKA
TIIVPYPLAGVWYLSLFANCTEWNESDCQRNISVKVQISLSPCKEGACGPHGRCIQYFSA
GLIYSACVCSSGFAGWSCSDGSNALSTAILLTSVLLLTLSNLFFIPAIFLAFRRGFYSQC
LLYFVTMFFSSFYHACDQPEFNFCLMPYTVLQFGDFYSALTSVWLTAFIVANPSVSEEIS
SAMCIGGAVGIAMAVHYNPTSLASFTIPIVCGLGLIAICWTRQSCQMHKCYPGKSYCLKA
VLPCLLFSIVGLVCFAFLETEDNYFYVHSIWHISIALAIVFVIPPEGKKFDITKPPSIDH
EPLSL
Download sequence
Identical sequences E9FUH7
jgi|Dappu1|311054|NCBI_GNO_0300407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]