SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|311061|NCBI_GNO_0300414 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|311061|NCBI_GNO_0300414
Domain Number 1 Region: 1287-1349
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.02e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 498-562
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000513
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 316-385
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000106
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1345-1402
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000756
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 369-432
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000208
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 251-312
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1223-1296
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000528
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 8 Region: 1165-1233
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000681
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 9 Region: 190-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000108
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 10 Region: 135-183
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000306
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 11 Region: 546-622
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000324
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 12 Region: 681-751
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000104
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 13 Region: 437-498
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000675
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number 14 Region: 1083-1194
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000263
Family I set domains 0.088
Further Details:      
 
Domain Number 15 Region: 913-976
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000391
Family Complement control module/SCR domain 0.0041
Further Details:      
 
Domain Number 16 Region: 740-799
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000405
Family Complement control module/SCR domain 0.005
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|311061|NCBI_GNO_0300414
Domain Number - Region: 809-873
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000391
Family Complement control module/SCR domain 0.0054
Further Details:      
 
Domain Number - Region: 1009-1050
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0667
Family Complement control module/SCR domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|311061|NCBI_GNO_0300414
Sequence length 1406
Sequence
MDDPVDSSSQKEEQKSQLVLVSIDLADSPIGGGDANDEDENDQDDVFIRPWNDGGLNLLP
AQSSYIPERKSFKNPRNVPSDSCPRDEDLAQAQGRTCLRKCLADEDCRSPRKKCLCDGIC
GLSCIKPDRECHDELGNPDRGNVILTGRLFGDRAIYTCEEGYRLVGVEFRLCQADGSWSA
TEPAFQSSGYCDEPPIVPNARHNAPQEQNSFAPDTELQYQCYLGYNTLGFARARCLQYNQ
TVKWFGPDFKCEARSCGEPTDITNGRHEGECHAFGCRVTYYCTAGFDLVGRANRYCQADG
TWTPGELPICVHLLSVQCPIPSDPDLGKAIFSSTSYNSIVSYECLYGNSLVGQPTRRCGP
DKRWMGEEPFCREINCGSPGLIPNGWIENLHLGTSLGTSIIYRCNKNMKRIGASSATCEK
SGRWSYNPPQCLSSCVVPMVERGVVRNVTAGSMVSHGENLTLECINLYEPAHGLATFTCN
NGTWNVIPRCEPARCKSLPRRPRHGMVIAPRMEHGSRALYKCKDGFQLAGSNVTECNYGN
WSGLPPTCQEIYCPFPGYIANGKVMLMGNMGYYDYRPYVKKVTNNRQIMYECDRGYKLDD
DGPPGATCVAGRWSPKQLPRCVAEQHSRGRWARSIKSGRTPVAIRPGGKKSSGKSTRRKQ
GSRRNEQDYDDGQQHESRDTCPPLAVEPHATVQVVTPGKNASDMFSTGVVLSITCAEGYR
LNVGNRTVRCKRGVWKPERPTCLLIPCTIPDVENSAFQLNDSTVLPANSEIPHNETAFFG
CNAGYVIQGPEVYRCWFGEYINTHGQTSECVAAPCELPRISYGEYTAGYRAGLTVANGST
VDYTCFEPNYVKINPGPIQCRLGEFIPDFPICRTRSDRFGVDDFGRIAWQEFKGGGDITE
GGIMVLMDRNKRNCSEPHRVHGSLVFRDGEPKEGEKNRFPHGSQVTFQCVSGLNKDRTTW
QIVCSDGSWNGRPLSCGLGQPSNKSCIFRNNEANLMTFYEDQQITEDVVEFPPGTELISR
CYDIGKFAFTGSVRRRCSRGDWTGMKPACVGLSQENDYALEKPPTILFRHQLGPIAQSND
GRLIVYPGTIVHMECLWIRRFGTPKWEVSHQYRKYPEGWTEEEGRDKTLEYRLSIFHAQK
DDSGTFTCTTPTRHQHSVEIIVHPVHCPAIVERKGLVASTKNTKMGVKVHFSCHNSNSLI
GAPELTCLPSGSWSSPTPFCESVLCPDITNITNDRILRVSIVSREVGGRALFSCPPGFTI
RGAGTESVCQSTGEWAQPLPRCEEVVCEPPTNPENGYIQGGSTYKAGEVVQFHCHRGFMV
EGQPIAVCQDNGKWSGTFPKCLPACPYPGTTIGGTISMVKFYYPIGETVTFDCSTGLVLQ
GSPNLHCQKGGKWSSAVPTCIPAQNN
Download sequence
Identical sequences E9FUI3
jgi|Dappu1|311061|NCBI_GNO_0300414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]