SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|311082|NCBI_GNO_0300435 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|311082|NCBI_GNO_0300435
Domain Number 1 Region: 100-163
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000068
Family Tachycitin 0.049
Further Details:      
 
Domain Number 2 Region: 301-362
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000732
Family Tachycitin 0.06
Further Details:      
 
Domain Number 3 Region: 533-601
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000133
Family Tachycitin 0.051
Further Details:      
 
Domain Number 4 Region: 598-654
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000034
Family Tachycitin 0.054
Further Details:      
 
Domain Number 5 Region: 21-91
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000628
Family Tachycitin 0.072
Further Details:      
 
Domain Number 6 Region: 452-519
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000126
Family Tachycitin 0.02
Further Details:      
 
Domain Number 7 Region: 204-269
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000254
Family Tachycitin 0.044
Further Details:      
 
Domain Number 8 Region: 365-409
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000128
Family Tachycitin 0.042
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|311082|NCBI_GNO_0300435
Domain Number - Region: 400-435
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0288
Family Tachycitin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|311082|NCBI_GNO_0300435
Sequence length 705
Sequence
MCCPLVPYCPKPLRTIIGERNSALCENAGDGFYAFPDNPNCNPNYYACIGGVQYNQTCPG
NSVFEPTYGNCLSPDTAPSCKITTTTPVSTTTVKATTTTTAPFSCTSDGFYPVGTCSTSY
YACVGGVVYPQTCPGNGIFDPSKSACVAPESLPSCPPITSTVPVTTTIPSTSTVTTPSTT
VATTTLTSTTTAPPTSTTTITTTPASTGTTIFTCTQDGFFPMGSCLSTYYACVGGISYVQ
TCPGNGIFVDTKCVTPQDVIGCDTTTSTTMSSSTTISTTMSSSTTTVISTTTASTTSTVS
SVAPFTCPTPEGFYPIPGACSADYFICVSGSPYVQSCPIGQVFNPKTQYCEPPINVPLCY
FSFVDFYQVCVLGSPYVSTCPNGTVFDPVTKLCTPIGWASCTSPFTCPTPDGFFPIPGAC
SNSYYTCVGNQAYLQGLHGYGGSRATGDIEIGPDPNFQCPEGTSVAPHPEKCGLYYTCYF
ASPVTLWQCYSNYLFDVTYSSCNYPESTDCGNRQRSGPTITATRTKSAADSPPSTSPVFN
CPSAGGFFPVSPEECYQHYYTCAGGVAYVMLCPTDGLFDPVTLTCKPANEVSCKDPAFTC
TADGFYPVEGECTGVYFVCASGVAYESVCPNNGIFDPDRGICASPDTVPCAQDRKADIDN
AKINKDYYTKCIENMCMAVYDVKRSYGGFNSAYYFNVLTYCIIFR
Download sequence
Identical sequences E9FUK6
jgi|Dappu1|311082|NCBI_GNO_0300435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]