SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|311375|NCBI_GNO_0400148 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|311375|NCBI_GNO_0400148
Domain Number 1 Region: 1940-2006
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000068
Family Tachycitin 0.028
Further Details:      
 
Domain Number 2 Region: 2022-2081
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000022
Family Tachycitin 0.034
Further Details:      
 
Domain Number 3 Region: 9-72
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000549
Family Tachycitin 0.038
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|311375|NCBI_GNO_0400148
Domain Number - Region: 162-259,2016-2038
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00162
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|311375|NCBI_GNO_0400148
Sequence length 2207
Sequence
MRGFPDTEPFVCKGAGFQRNETDCTQFFRCVDFNNNGKHTIFRFMCGPMAVFDESRSLCT
GPELSVPPCPKDQLDAFFVSMKPMAPAVTELSSPDPVPTVTSTEAPVPTQAPVTVPATPA
ATPAPTSASTATPVTVPATAAPPVIVTETSTATSAPVIITDPPVTTPASTPQPVTVPVTQ
PTPSTTLEPVTVPTVAPTSAPTLAPVPEQTVPPVTIPVPATTPEIITTTTTPATTTVTEP
STIPATVSVPVGPLTPTPVPTTTPVIEVETTTIAAPVVTAEPPTPSTTTPSTSTVENNTG
SEILPEVISTVPPVSVSTDAPTTPTTTEAVTETPVKPTTPPTPPTVSTLPPVTVTTSGTT
TTPAPAITIGDDIKGFISIGEKETIQNVQQVISTITVNPGVTWAVTSQGEGSRIILKEDG
TGETTFSVIPPGSILIINTTRTGGAWNNVANGIFTTNSTTTSFPPGTTFSIVKIGATGQI
ISTQTILTTTSTSTLTVPTNSFVGSIKFVNQKIVTIGGWTFSTTYFTTGTTISSFGVLQP
STTTTSTSSQTTITTTSTTITGDQQFISGIITVGAQSEASPSTKNLSIPGGDLLAIVPQG
GQGIVTLIEEGSTLDTDFPVTPGSFLAVLAPSNGVGIVTNVVQSIFTSNMTTITFPAGST
VSILKVGIDGQLIRVSFVQINTSFTLFTTSQSIVGIVQTTQTGVISNIGTGTFSTQLLAG
STKPIYFGVVNVNPIISTTTQVESLSGIIQIGDSTFLNPQQSTTTVQTIQILPGTTSAIL
VSGEVKITEEDGTSIKQTAVSIPSGGILGFVTLKSGGEISGISNGYFTTTSTQIIFPSGT
RFGIVIIRADGTMSLQNPIDSTVKTTITVPVGSVFGVLTLSSNGVVTGIGSALFSTQYLL
LGDSTGPEVPATLGNFGVVYFSEQFTLSQSTVINSAPVLQKLETISAIVQIGVKDRFDSI
TSLSVPTGSSFVIIPSTGQGVVTVIEGGATSTFSVLPGQLFVVFNVQDATVTNIGDRFFT
TTTTTINFGTGSQYGIIKIGLEGQIILTEFSRIAQSGITITVTTGSTVGTLQQTSDNRNI
ITSIGGAPFVIKIMTNVSPLTATDLTTSAGVLDIGSFTTVPVLPPIAPETTTPTTLAPVT
GTVITSAPVTSAPGVVTNPPSPSTDTTPASTISTEKPEVAVEDIKGFLTIGEKEIIQNTQ
TVTPSIAVPSGSTWGVVSQGSGSQIVIKQGDSSETTHSIPPGSVLVISTTENGGVWNNVA
NGIFTTSSTTTSFPSGTKFSIVKIGATGQIISTQTILTTTSTCSLTVPTNSFVGSVQFAN
QKVVTIGGWIFMTTYFTTGTTTSSFGVLQPSTTTTSTNSQTIITTTSTTITGDQQFVSGI
ITVGAPTEPSQPAQDLTVPSNNLLAIIPEGGKGVVTVVGQTSQEFSITPGTFFGVLTPSN
GVGTITNLAQPMFTTATTSMTFPAGSSVAVYKVGIDGKIVRISVFEFTTTFTIITSLRST
VGIVQTTNTGLLSNIGTGSFSTQTLTGSTASVIFGVLNFNSFQTSQVESLFGILQVGDAT
FLNRQEAAGQTISIPASSTSAIIASGDIIVTEETETSSTQTTFSIPSGGIFSMVAPSSGG
AISGIVSGYFTTSQTKITFQSGATVGIVTIRPDGTMSVQNPVVTKVKTTITVPAGSTYGL
IILSAENVVTGIGSTSFTTQNLLISDSTGPDVPAVLGNFGVMFFSEQFQLSKSIVVSSAQ
VSSQLQTLSSIIQIGVKEKFASVADLSVASGSSFGIIPAKGQGIVTVNEGGSTSTFMVLP
GQIFGLLNAQGALVTQIGDGFFTTSTTTMSFGSGTIYGVVKIGLDGSMISTEFTRTAQAS
FTVTVASGSTAGIIQLASASSRVITSIGGASFAIRILTSTTTSSSGGSVGMLDLVGSVPR
PAVPTVGTTLRPPVSTPQPPSAGPFTIDCSLNQLHQFPLDCSRFYQCFGEDTDRTVYIFP
CAPGLVFDEATSQCLTPSEGICDDQSSINDTASSSQGVGGFFQINCSGDLYRYPLNCNNF
YQCFKNEQGQETIFVFSCAAGLVFDENSRTCLLASETSSCAVNDNIFRSPNLVFQLKQKI
DILSLISTSRTIVQQKSSSSTISEISFSQPHQSGRGSTKRKMGYEGEADRQVGQRRINTD
SRKGKESKSTAATTVTGNFRPRLFDSGVYGVRISPLSKSLFGQSKTN
Download sequence
Identical sequences E9FWQ5
jgi|Dappu1|311375|NCBI_GNO_0400148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]