SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|312107|NCBI_GNO_0500276 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|312107|NCBI_GNO_0500276
Domain Number 1 Region: 208-255
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000144
Family Tachycitin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|312107|NCBI_GNO_0500276
Sequence length 256
Sequence
MKPSILLRLTMVLCVSCLAVTSAARSTKPEGERRQIFRDEVAHMKGIKRPELVNQQGYFP
PQEQDHYERPTKPAYQDNYPPGNQGDYKPTYQKPEAEYGGYDQYEDPKPYVPPPPQYDDY
EPVKPVVSKPYKPIVPKPYKPRPTYPKEIVLLQPSTALKSNAYADKYTTPSYRPSHIPGN
PGEDYPNYTAIPETSFDCLNLKNADFSYMFSDPEAGCQVFHTCHHDGRQDSFLCPLGTIF
DLESQTCDWWFNVRCI
Download sequence
Identical sequences E9FYV8
jgi|Dappu1|312107|NCBI_GNO_0500276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]