SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|313404|NCBI_GNO_0900027 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|313404|NCBI_GNO_0900027
Domain Number 1 Region: 881-1177
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 8.64e-83
Family Complement components 0.0000398
Further Details:      
 
Domain Number 2 Region: 1251-1382
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.66e-29
Family Alpha-macroglobulin receptor domain 0.001
Further Details:      
 
Domain Number 3 Region: 714-767
Classification Level Classification E-value
Superfamily E set domains 0.000013
Family Arrestin/Vps26-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|313404|NCBI_GNO_0900027
Sequence length 1439
Sequence
MRVGSEKDPTRDACDVIMLLRLLLAVAFFTCTLAQNDGTYTIVAPKVLRPSLDYHVSISL
HGGAPLTNLVVAIEGQQDGGGQVRNAQSATVEPNSTQVIKFQIGELGPGKYNLTARGSGG
LTFVNTTELEYSEKSHSVFIQTDKAIYKPGHLVQFRVIVVNPQLKPSVVGSLDVYMTDGK
GNRIKQWNRVFTKQGVFASELQLSDQPVLGDWNITAVVSGQSFSKHFQVAEYILPKFQVT
IDLPTYLTFNESKMVATVKAKYTYGKPVKGNVTIAAYPQYRVSYIQPFFTEPVRKTVQID
GTVDVDFNLFKELKLVDDFERDIRFDVTVIEGLTERKQNMSSLLTLYKYKYKMELIKTSD
SFKPGLKYTAFLKLAYQDNTPIQDANGVVIVKHGFSHNQDEYNRTEYPVPRNGILELNFY
PPVDENVYTLGIETQYQDLVEWFSTINRAQSPSNSFIQVILKTENPKVNEEIAIEVNSTA
PLDSYIYEVMGRGNLVVARTVQAGNQRSHTFRFQATAAMAPVARVVVYYVRADGEVVADA
LNFDVDGTFQNFVDIQVTPDSVEPGKAVDIVVKAKPNSYVGVLGVDQSVLLLKTGNDISR
QDVLDEVKSYDSTRRPDFESWLPEVGGPKMCEELRLAAPTLSVDVSFSKKVEEPIALRQH
FPETFLWLDITNLGTDGTARFVKEAPDTITSWVITAFSLDTFHGLGVIEQPAKMQVFRPF
FIQLNLPYSVIRGEVVAIQAVVFNYMNKEITAELTFENIGDFQFIDNGLEDNEISSEAIF
RKKSVRIPAQDGTPVSFLIRPTTLGNIDLRLTAKAATAGDAIVKKLLVKAEGETIYRNKA
YLLDLRSIRNYNKNVSVTIPFNAVPGSAAVELSAIVDIMGPSINNLNTLLRMPFGCGEQN
MLLFVPNIVVTEYLKNIGQLTDAISSKALGFMETGYQKELTYKRDDGSFSAFGKSDAAGS
TWLTAFVARSFRQAQPYITIEDHVIEDSLKWLSANQAPNGSFPEVGKVSHTDMQGGSGKG
VPLTAYVLLAFLENKAGLRYGPSMQKAAEFLVKELPSITDPYALSLVTYALHLAEVEERD
AAFDMLQAKANTTDEEFRFWSKPKSEKDKSNPWSSLTTSVDVEMTAYALLTFLQRGLVIE
ALPIMKWMVANRNSNGGFSSTQDTVIGLYALAKLAEKITVPNTNINVKIKHDTGAETFSL
NRENAMVLQKFKLPPKTSHVEISAVGSGFSIIQVSTSYNLNVTGEWPLFTLDPQLFKNAN
QNRMQLTICSSFVGEESNMAVMEISLPSGYVMDEDSLPSLRAIKDVKKVETKEGGTGISL
YFDKMTRNTVCPTVQAYRVFKVAEQRKVPVVMYDYYDSSRRARVFYEPVPANVCDICQSN
DCKNQCSSYPGWSGDEEGSKGWGTLDGRSNSRPTSGQQSLLPTLLCFVLSGLTSALLLI
Download sequence
Identical sequences E9G461
jgi|Dappu1|313404|NCBI_GNO_0900027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]