SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|313443|NCBI_GNO_0900069 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|313443|NCBI_GNO_0900069
Domain Number 1 Region: 78-141
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000392
Family Tachycitin 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|313443|NCBI_GNO_0900069
Sequence length 143
Sequence
MPEAAAVEHFTENSSGLAGSVAEGHLATPMPKHRFSSMLSAARKLTKAGACSLPDDPSVD
LALDHFGSNLPVTKIISIPVTEFSCNDRQPGYYADRDREASCKIFHYCYEDNPIVSFICP
TCTLFHDEKQLCDYWYNVDCKVG
Download sequence
Identical sequences E9G497
jgi|Dappu1|313443|NCBI_GNO_0900069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]