SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|313559|NCBI_GNO_0900185 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|313559|NCBI_GNO_0900185
Domain Number 1 Region: 2669-2857
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-36
Family Laminin G-like module 0.00035
Further Details:      
 
Domain Number 2 Region: 2477-2524,2553-2666
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-25
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 2043-2210
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.13e-24
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 4 Region: 2230-2445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.96e-23
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 5 Region: 1839-2034
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.43e-18
Family Laminin G-like module 0.0071
Further Details:      
 
Domain Number 6 Region: 541-593
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000159
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 7 Region: 1165-1214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family Laminin-type module 0.0049
Further Details:      
 
Domain Number 8 Region: 786-835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000212
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 9 Region: 591-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000222
Family Laminin-type module 0.0045
Further Details:      
 
Domain Number 10 Region: 483-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000837
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 11 Region: 833-877
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 12 Region: 643-684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000153
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 13 Region: 690-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000314
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|313559|NCBI_GNO_0900185
Domain Number - Region: 1267-1314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000201
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number - Region: 164-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000204
Family Laminin-type module 0.034
Further Details:      
 
Domain Number - Region: 163-258,448-467
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000298
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 1221-1269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00137
Family Laminin-type module 0.046
Further Details:      
 
Domain Number - Region: 738-783
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family Laminin-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|313559|NCBI_GNO_0900185
Sequence length 2858
Sequence
MTDHQDIQLMTKFIDLKSIKLLKWSTQGKESVAMCCSQRLKLLVLQPFQGPIQPQRIACH
LNTFSQSFTGSHLLMINPSQKHHHVFQVAYVVVKSAISPRPGNWILERSIDGVTFLPWQY
YALSEAECISRYGIEPREGNPTYRSDSEVICTAFYSKLDPLEDGEGGGVCLNCTDFTTGI
NCEKCLDGYFRPDSNSGQCRCRVGFAGSKCDRCASGYHSKTNVEGERCDRCRPGFFDLRQ
DNPEGCSRCFCFDRSGRCGRRVVTPTAEPNEKDGHNNNRSRLSIANDDMADFESYYWLAP
PDYLGKKLTAYSQTVKFQVAWVKARGDSAGKATKGPDVIMEGGGMKIGYGDRSYHRDSNT
TISWTLRESKHWYHIPDTVADIVRRRRTEYKGEAVTKTQLMTVLNDLRRLLVRAKFHTDQ
IEGVLHDAELDVGSEESTSVERARGIEQCFCPPGYAGLSCEDCAFGYVRRNSSRRGEFEC
LACQCNGHAATCQVDDLTACSPCLHNTTGHQCDACATGYHGDARSGGSCKRCRCPLDTPA
TNNFSPTCLTTGPDSYVCDQCPPGYEGHHCQRCADGYYGNPLVAGGFCQPCDCSSNQEIG
SSDWCDRLTGQCLKCKTGTAGQACQLCATGYYGNATEGTCQECRCYSQGSASNQCDLETG
QCQCRDRFVGKHCNRCRDGYGDIEAGCRDCQCDLVGSLTASTCDVQTGQCNCKPGVGTLA
CNQCLQDHYDFSINGCQECEPCDKPGHICDPDTGRCVCPTGTEGPQCQTCVAGAWNHHPL
KGCKTCNCHAQGSRSSQCEQSTGACSCRPGFAGMQCDRCIQPGFYGFPMCQRCDCHPTGT
DTLNTNGHCGQQDGQCPCKANVMGRRCDTCKESTFGLLQVGPASTETDHQQQQHQELMTR
HSFDDGGCTPCFCFGRSSSCTQAQLFWSQLALPGDGQLQFKTGETQLNVTNNLRIVPDVR
GDVMIGVSQFFDTPLYWQLPGSFSGDRTTSYNGLLRFTVTNDGGSTLFPDNILATYPLVQ
IQGNRKIILEYYPHAPHPNGRYQVRLHESLWRMKNNPQAKVSRAMMMVALQNVQHILIRA
TDSMDRIKAELKDVSLEVALPASPTNSTTHRNSPALARGVETCQCPLEYTGGSCQDPHRG
YYRRFKYDYVSSTVLIDLVGDAQPCHCNGRSETCDRETGRCTNCRESTTGDHCQQCAKGF
YGKPNQPGGCRPCACPSTDRNFADSCQLLRNGSQSCQCARGFRGDRCQKCDYGYYGNPSQ
GVACQPCLCNVNGSVSDECHELTGHCNCKPGITGRDCTYCAPRHVISPTGCTSCQDGCTG
ALFAEVDEMAGMIARFNVTEYVPLPWTGLFYQQNVTVLLEQTLVERREEYQMTDRLLTGP
NILPLAQITLQRAKEMESLAERFQTEAADLQPVCLESQESSILVSSILEEIIAYLKNYAI
GETPSVNINKALAEAENHWTYIQSIDVTARKSNAARELERSRNLLNSLGNLFDDGSDTAQ
VRDHLEGFKIRLDDLETYIYKSRNSTEAAFQSLSFKRERYAGHQPGPGGFPGIDDVAGTA
EGQKAQCSARESELSRLNPEYKRKYVQAAQVHANHLWKQAQGLFNQFNATRDVADHPLQA
ANAYKSIVEALKLARQAAEAAGEAAETAYGRAYPDDVDLSLVEQARISRDKSRDFVQRSE
RLKTVVSSHKEQLKGEHIKLDSVDSILKKAKSINDETSAHLDKLPQVRDKAKAAVEKSTD
ALGKSNVVSKQMMDIKAQIDSDLRVRLLAMQNGRNVGLGNIPKLVDDARKNMKHLDAKMT
HLTKKNFEFRSINSSVSLKLDELRKKIMRAKQAASSIRVSLSGNSGSCARSFTPPLQPSS
VSSIMLTFALNHKDRDSLLFYLPATKKHGNDQETDFLAVEMLDRQIRFLWNAGGGTTVLS
HPLKLQPSPDDLSDDSRWYKIEAERTGNVGSLRVRPVKPENDRDIEGVTVTGAGPARFTK
IDLTTGDKLYIGRVPDNAPTDLKTSKFSGHLHQLWYDGQPVGLWNFMSTSAAGCSPSMEG
AQEAKDESSFRFNGQGYAELAQIPRYDSRQYSITFSFKSLDENALLFLAINETHLGQYIS
LELTEGLIRYQVRYGSGYEMSLQSRQKYNTGQWVKVEASRVLIRGVETALLKVADDEELS
AAPFNFGVPDLELEEAKLYVGGLPPDVSISPDLMGSVPGSFLGCMKDLQVVAFGMNPLQG
SFYGVEASCGSQTINKIVAFAGTGYIQLRAARPTGRDMNFGLSFKTEMPEGILFFSAPIP
AESSDEPANDEELPIRLPLKSDKEADMMSLTIRQGKLDARFRSSAAEVVSITSSGVYNDG
QFHNVVVVRTGRKVEVLVDDISIGTIRLARQVGGSSSSGAYSGSDYSHLMLGGVRPEWLS
MASDFIGTQHSFTGCIADLSFNNQLVDLSYPVRHSAAAVGRCQHVPVPRVLEERMQANEN
ALASCREVPQYTIEGRAFKFGDAPNSHVMISANRKELHNSFNFTMDFRTHYPNGLLLFSS
VRMNLIAIIFKVNWIKLWNKFFLKQMKQKKAANYLLAALKNGKVVVSLHGRRKEDLISAG
SVNDGHWHRVHIVKDKRKVVVMLDDFAPLRAKAPNKLQLDGQLFVGGLPESSPLLDNAAA
EGFKGCIRNLNLNGRSHDLASSKNVIQRVGQCFAHVETGSYFPGDAYAVYSEDFRVGAMA
DIQLEFRTTELNGVLLSVSERKGSPSLSLAIDDGTIVFAVDMGDNRTFSVSQSFASPYQL
CDNRWHSVKANYVENALTLKVDHQDEQYGFSSNGHVKEAKTRNPLFIGGLPELEPQGALR
VRDNFKGCIRNVVIRGEIKDWTDMARLNNVLLNACPTN
Download sequence
Identical sequences E9G3G9
jgi|Dappu1|313559|NCBI_GNO_0900185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]