SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|313644|NCBI_GNO_0900272 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|313644|NCBI_GNO_0900272
Domain Number 1 Region: 776-838
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000778
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 2 Region: 522-581
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000653
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 721-789
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000584
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 4 Region: 861-917
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000153
Family Complement control module/SCR domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|313644|NCBI_GNO_0900272
Sequence length 1084
Sequence
MKLNTQSVLVLFCLLLANALAEPNREKRSPDGHGHGHHHDHSHDHEHEHGHGGGVPIHTP
DVSPQYYAQQYASPPSYDAQPSEYQEQQPYEEHQAASSFDAPKGPQEYDTPYYSSPSAPE
YSPPAPEYSPPAPEYSPPAPEYSPPAPEYNSPAPAYSPPAPAYSPPAPAYSPPAPYSPPA
PSYSPSAPQSYQTPAAPSYNPPAASYSAPTAQYSPSYEAPQETYEVPQYSYGAPKGKKPK
GSYGAPKATKAPKAKKPKGSYGAPKATKKPKSSYGPPKHSYSAPLQSYSAPAPSYQAPTP
SYQAPSYQAPAPSYQAPSCWLIFFFTLVQSYHAAISCPASTPVKLNTFCHHSQVSVPFPF
ECDATPVNYCHNAENLLQPNNSTKVYLDGNRFFDGDLIGNCWNDSTTTYSQSGHWQIKLD
TIQNIYAVLVRTLGPARNQSSSFRVSLTRHVSSNRSETTRCHDFNYRDGYHTFYCYHPDE
ALTTSYRPGFDAKFVDIIGEIYIDETCDFTNIVKLYSYPVRVCGIPEAHHNQTIDPRANY
YLIGQQVTYKCSDDVHTLIGQPDRVCQHNGLWSGNTPMCVLVRKFQPQSQLIHRMGNTEL
YWPADRLSNATRLDEMEMITYGFEAEYCINRILLEYHSELSQGTELSVYTTSVDGTRHIW
AANGTFGKYSNKQYFVPRVPFVCCLNVTIQRHQDLATRAIFKRSEFIYQIEADGYPHREF
HCLRPHLFPNMKFPIKPNHTIENGVAVQIECSKGFHQQNADPAEIQCENGIWKGRFPICE
RKHCPQPIKRSHSSWNYENKGLKFNQVRYKCDHGFELQGRNVATCIDGRWTSPSPTCKVT
FCPSFTTPPNLFCMLNRKNEFYDATGNGTVFHHGIGLVCYCQFGFRAIGNRTVRCDNQEW
TSELPQCQKILCGSPPFLIPSGANNSIIQQRRWEIGLHNFTCPDELVIKGYNDQTSLELI
CQENGQWGETEVFECVNQPKGLECYVIAGIVMGVILGLALITVSVVFGKRLMRKADKTKK
INESRRNLTIVEDDYNQSYISYSEEMDEGPCIALIDGYITKPFYSTYDTKLIESSESEID
VETF
Download sequence
Identical sequences E9G3Q3
jgi|Dappu1|313644|NCBI_GNO_0900272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]